KEGG   Candidatus Ruthia magnifica (Calyptogena magnifica): Rmag_1030Help
Entry
Rmag_1030         CDS       T00438                                 

Definition
(GenBank) UDP-N-acetylglucosamine pyrophosphorylase
  KO
K04042  bifunctional UDP-N-acetylglucosamine pyrophosphorylase / Glucosamine-1-phosphate N-acetyltransferase [EC:2.7.7.23 2.3.1.157]
Organism
rma  Candidatus Ruthia magnifica (Calyptogena magnifica)
Pathway
rma00520  Amino sugar and nucleotide sugar metabolism
rma01100  Metabolic pathways
rma01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Rmag_1030
Enzymes [BR:rma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.157  glucosamine-1-phosphate N-acetyltransferase
     Rmag_1030
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.23  UDP-N-acetylglucosamine diphosphorylase
     Rmag_1030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexapep NTP_transf_3 NTP_transferase Hexapep_2 IspD CofC Fucokinase DUF4954 Phage_holin_3_2
Motif
Other DBs
NCBI-ProteinID: ABL02735
UniProt: A1AXS8
Position
1110422..1111780
Genome map
AA seq 452 aa AA seqDB search
MKNIHAIILAAGKGSRMNSSKPKVLQTLSNNTLLGHILSQVKGLCDKVHVVYGFEGNQVQ
RKINDSNINWVEQTEQLGTGHAVAQAMPHIEDNSISLILYGDVPLIKKSTLADLIHKAQQ
SGLSLLSVILDNPTGYGRIIRKDKQIQAIVEQKDATNTQLNINEVNTGIMAVHSQLLKQY
LSKINSSNAQGELYLTDIIACAITDGQIVSSIISKNKFEIAGVNDKVQLAELERIFQINQ
ATQFMQQGLSLKDPNRFDCRGVFTFGKDCEIDINALIEGEVVLGDNTIIAPNCIIKNSKI
GNCISILSNCVIEDCVIEDGATIGPFARIRPNTHIKTYAKIGNFVEVKKSIIGENTNVSH
LSYIGDAIIGKNVNISAGVITCNYDGINKHQTIIGDGAFIGSDSQLVAPIKIGKNATIGA
GSTITKAAPDNQLSLSRTKQISLKNWQRPTKK
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatattcacgctattattttggccgcaggcaaaggctcgcgtatgaactcatct
aaaccaaaagttttgcaaaccttatcaaataacaccttattggggcatattttgtctcaa
gttaaaggcttgtgcgataaagttcatgtagtttatggctttgaaggcaaccaagtacaa
cgaaaaattaacgattccaatatcaactgggtagagcaaaccgaacagttaggtactgga
cacgccgttgctcaagcaatgccacatattgaggacaattcaatttcactcatattatat
ggtgatgttcctctgattaaaaaatccacactagctgatttaattcataaagcacaacaa
agtggcctttctttattgtctgtaattttagacaatccaactggatatggacgtatcatt
cgtaaagacaagcaaatacaagccattgttgaacaaaaagatgcaactaatacgcaacta
aatattaatgaagtgaatacgggcattatggctgttcactcacaattattaaaacagtat
ttaagcaaaatcaactcaagcaacgcccaaggagagctttatttaaccgatattattgct
tgcgcaatcactgatggacaaattgtttcatccattattagcaaaaataaatttgagata
gcgggtgtaaatgataaagtacaattggcagaattagaacgtattttccaaataaatcaa
gcaacacaatttatgcaacaagggcttagtttaaaagacccaaataggtttgattgtcga
ggtgtattcacctttgggaaagattgcgagattgacattaacgcgctcattgaaggcgag
gtagtactaggagacaatactataattgcaccgaattgtattataaaaaactccaaaata
ggcaattgtatatcaattttatcaaactgcgttattgaagattgcgttattgaagatggc
gccactattggtccatttgcacgcattcgtccaaacactcacatcaaaacttatgccaaa
attggtaattttgttgaagttaaaaagtccatcattggtgaaaacaccaatgtttctcat
ttaagctatataggcgatgccattatcggcaagaacgtcaacattagcgctggtgtcata
acttgtaattacgatggtattaacaaacatcaaaccatcattggcgatggtgcattcatt
ggttctgattctcaactagttgcacccatcaaaattggtaaaaatgccacaattggtgca
ggttccaccatcactaaagcagcacctgataatcaattaagtttaagtcgtaccaaacaa
atcagcctaaaaaattggcaacgtccgactaaaaaataa

DBGET integrated database retrieval system