KEGG   Epibacterium mobile: K529_001570Help
Entry
K529_001570       CDS       T04367                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rmb  Epibacterium mobile
Pathway
rmb00071  Fatty acid degradation
rmb00072  Synthesis and degradation of ketone bodies
rmb00280  Valine, leucine and isoleucine degradation
rmb00310  Lysine degradation
rmb00362  Benzoate degradation
rmb00380  Tryptophan metabolism
rmb00620  Pyruvate metabolism
rmb00630  Glyoxylate and dicarboxylate metabolism
rmb00640  Propanoate metabolism
rmb00650  Butanoate metabolism
rmb00900  Terpenoid backbone biosynthesis
rmb01100  Metabolic pathways
rmb01110  Biosynthesis of secondary metabolites
rmb01120  Microbial metabolism in diverse environments
rmb01130  Biosynthesis of antibiotics
rmb01200  Carbon metabolism
rmb01212  Fatty acid metabolism
rmb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rmb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    K529_001570
   00630 Glyoxylate and dicarboxylate metabolism
    K529_001570
   00640 Propanoate metabolism
    K529_001570
   00650 Butanoate metabolism
    K529_001570
  09103 Lipid metabolism
   00071 Fatty acid degradation
    K529_001570
   00072 Synthesis and degradation of ketone bodies
    K529_001570
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    K529_001570
   00310 Lysine degradation
    K529_001570
   00380 Tryptophan metabolism
    K529_001570
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    K529_001570
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    K529_001570
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    K529_001570
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rmb04147]
    K529_001570
Enzymes [BR:rmb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     K529_001570
Exosome [BR:rmb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   K529_001570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ANP39441
UniProt: A0A1B0ZYS7
Position
322015..323193
Genome map
AA seq 392 aa AA seqDB search
MKQAVIVSTARTGLAKSYRGAFNDTHGAHIAGHAIQHAVARSKVDPALIEDAFIGCGYPE
GWTGGNIARQAVVRAGLPVTVAAATVNRFCSSGLQAIAMAGHAVTLEGASAAIAGGVESI
SQMPPSRPAQRRDEWIEANKSEVYMTMIETADVVAQRYGVSREAQDELSLESQMRTAAAQ
AAGKLDDEIVPITVTQKITDKETKEVSYKEVTFSMDDCNRPNTTLEGLAGLKPVRGEGNF
VTAGNASQLSDGAAALVVMDADLAAQQGLEPLGALKGFVTAGCEPDEMGIGPVFAVPRLL
ERHGLKVSDIDLWELNEAFASQALYCRERLEIDPAICNVNGGSISIGHPFGMTGARMTGH
LLLEGKRRGAKLGVVTMCIGGGQGAAGLFEIF
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaagccgttatcgtctccactgcccgcacgggtctcgccaaatcctatcgcggc
gccttcaacgacacccatggtgcccatatcgcgggccatgcgatccaacatgctgtcgcg
cgttccaaagtggacccggcactgattgaggatgcgtttattggctgcggctatccagag
ggctggactggcggcaatatcgcacgtcaggctgtggtgcgcgcggggctgccggtgacg
gtggccgctgcgacggtgaaccgtttttgctcgtccgggctgcaggccatcgccatggcg
ggtcatgcggttacactagagggcgcctctgccgccatcgcgggcggtgtggaaagcatc
agccaaatgccgccctcgcgcccggcgcaacgccgggacgaatggatcgaggcgaataag
tccgaagtctatatgaccatgatcgagaccgccgatgtggttgcgcagcgttatggcgtg
agccgcgaggcgcaggacgagctgtcactggaaagccagatgcgcacggcagcggcgcag
gctgcaggcaagctcgacgatgaaatcgtacccatcactgtgacgcagaagatcaccgat
aaggaaaccaaggaggtctcctataaagaggtgacattctcgatggatgactgcaaccga
cccaacaccacgcttgagggtctcgcgggtctgaaacccgtgcgcggcgagggtaacttt
gtgaccgctggcaacgcctcgcaactctccgatggggcggcggcgttggtggtgatggac
gcagatcttgccgcacagcaaggactagagccgcttggcgcgcttaaggggtttgtcacc
gcaggctgtgaacccgatgagatggggatcggcccggtctttgcggtgccgcgcctgttg
gaacgccatggtctgaaggtttccgacatcgacctgtgggaactcaacgaggcctttgcg
tcgcaggcgctttactgtcgtgaacggctggagattgatcctgcaatttgcaacgtgaac
ggtgggtccatttctatcggccacccctttggcatgacgggcgcacggatgacggggcat
ttgctccttgagggcaagcgccggggggcgaaactcggtgtggtgaccatgtgcatcggt
ggggggcagggcgcggcaggcctatttgagatcttctga

DBGET integrated database retrieval system