KEGG   Epibacterium mobile: K529_002030Help
Entry
K529_002030       CDS       T04367                                 

Definition
(GenBank) alpha/beta hydrolase
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
rmb  Epibacterium mobile
Pathway
rmb00903  Limonene and pinene degradation
rmb00930  Caprolactam degradation
rmb01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rmb00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    K529_002030
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    K529_002030
Enzymes [BR:rmb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     K529_002030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Say1_Mug180 Peptidase_S9 Thioesterase Abhydrolase_2
Motif
Other DBs
NCBI-ProteinID: ANP39532
UniProt: A0A1B0ZYX0
Position
422665..423552
Genome map
AA seq 295 aa AA seqDB search
MSRALNLLVAGLRHLVRPRLQRVKGPEEARASFERTARLVFQTPPYLCHIADRAGLDRIR
CGPCTPGKIILYFHGGGYIAGSSKSHAAMLGRLSRLSGLEVCAPDYPLAPEQPAPAAFDA
AVAAWAHLIASGYAPSDVVIGGDSAGGGLALALLSHLCRAGTPPAALFAMSPWCDLTLSG
ESLTRNADRDPFLPVARIRELVDYVVPAGMQPADPRVSPLFAAFPDCPPVLLQYGETEIL
FDDCRRMAEHLRGSGAEVSEYLHPTAPHVWHLFDGWIPEARRSLCDIAYFARMNL
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgcgcacttaacctgttggtggcagggctgcgccatctggtgcggccccggttg
cagcgtgtcaaagggccagaagaggcgcgcgcatcgtttgagcgcaccgcacgtctggtg
tttcagacgccgccatacctgtgccatatcgcggatcgcgcggggctggatcgtatccgg
tgtggtccctgcacgccgggtaaaatcatcctttactttcatggcggtggctatatcgcg
ggtagctccaagagccacgcggcgatgctgggtcggctttcgcgcctttctgggttggag
gtctgcgccccggattatccgctcgcgccagagcagcccgctccggcggcctttgacgca
gccgttgcggcgtgggcgcatctgatcgcatcggggtatgccccctctgatgtggtgatt
ggcggggactccgcagggggcgggctggcactggcgctgctgtcgcatctgtgccgcgcg
ggcacgccgccagcggccctgtttgccatgtcgccgtggtgtgatctgaccctgagtggt
gagagcctgacccgcaacgcagaccgggatccttttctgccggtcgcgcgcatcagagag
ctggtggattatgtggttccagcgggcatgcagcctgctgatccacgagtatcgccccta
tttgccgcgtttcccgactgtccgccggttctgttacagtatggcgaaaccgaaatcctg
tttgatgactgtcgccgcatggcggagcatctgcgtggatctggtgcagaggtctcagag
tatctgcaccccacagcgccccatgtctggcacctgtttgatggttggattcctgaggcg
cgcaggtcgctttgcgatattgcctatttcgcccgcatgaacctctag

DBGET integrated database retrieval system