KEGG   Epibacterium mobile: K529_012925Help
Entry
K529_012925       CDS       T04367                                 

Definition
(GenBank) haloacid dehalogenase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
rmb  Epibacterium mobile
Pathway
rmb00361  Chlorocyclohexane and chlorobenzene degradation
rmb00625  Chloroalkane and chloroalkene degradation
rmb01100  Metabolic pathways
rmb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rmb00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    K529_012925
   00361 Chlorocyclohexane and chlorobenzene degradation
    K529_012925
Enzymes [BR:rmb01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     K529_012925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: ANP41675
UniProt: A0A1B1A521
Position
2730724..2731344
Genome map
AA seq 206 aa AA seqDB search
MPVTAVVFDIGRVLIEWEPERFFDTLIGEPRRHALFKEVDLHGANLDVDRGHPFRETIYG
LAEKHPEWAEEIRHWHDSWIKMASPEIPHSVRLLRALKAKGVPVYALTNFGAETFVIAQT
HYPFLREFDQAFVSAHLRCIKPDAEIYAHLEQGTGRRPDELLFTDDRPENITAAAVRGWK
THLFDHPKTWAARLVEEGLLSEEDAR
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgcccgttaccgccgtcgtctttgatattggtcgtgttctgattgaatgggagcctgag
cgcttctttgacacattgattggagagccacgtcgccatgcgctctttaaggaggtggat
ctgcacggggcgaacctcgatgtggatcgtggacatccgtttcgcgagacgatctatggg
ctggcagaaaaacacccggagtgggcggaggaaatccgccattggcatgacagctggatc
aagatggccagccccgagatcccccattcggtgcggctgctgcgcgccctaaaggccaag
ggggtgccggtttatgcgctgacgaacttcggggcagagacctttgtgattgcgcagacc
cattatccgttcctgcgcgagttcgatcaggcctttgtgtcggcgcatctgcgctgcatc
aaaccggatgcggagatttatgcgcatctggaacagggcacaggacgccgccccgacgag
ctgttgtttacagatgatcgccccgaaaacattaccgcagcggcggtgcggggctggaaa
acccatctgtttgaccacccgaaaacttgggccgcgcggctggtggaggaagggctgctg
agcgaagaggacgcccgatga

DBGET integrated database retrieval system