KEGG   Epibacterium mobile: K529_017820Help
Entry
K529_017820       CDS       T04367                                 

Definition
(GenBank) amino acid decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
rmb  Epibacterium mobile
Pathway
rmb00350  Tyrosine metabolism
rmb00360  Phenylalanine metabolism
rmb00380  Tryptophan metabolism
rmb01100  Metabolic pathways
rmb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rmb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    K529_017820
   00360 Phenylalanine metabolism
    K529_017820
   00380 Tryptophan metabolism
    K529_017820
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rmb04147]
    K529_017820
Enzymes [BR:rmb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     K529_017820
    4.1.1.105  L-tryptophan decarboxylase
     K529_017820
Exosome [BR:rmb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   K529_017820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase MoCF_biosynth
Motif
Other DBs
NCBI-ProteinID: ANP42620
UniProt: A0A1B1A7V2
Position
unnamed1:492627..494039
Genome map
AA seq 470 aa AA seqDB search
MNWTDFASWGRKVADWAQDYHLTVGERPVRAQTKPGDMLNALPETPPEHGEGMEAIFADF
EEKVMPGITHWQHPRFFAYFASNAAAPSVLAEFLTSAIAPQCMLWQTSPAATEMETRMMD
WLRQSLGLPGEFRGVIQDSASSATLAAVLTMRERALNWQGNQQGLAGQPTLRIYCSAEVH
TSVDRAIWVAGIGQANLVRVPIKGDWRGMDPAALNAAIEADKAASLHPAGVILCVGGTGT
AATDPIADCIKVAQNHGLYTHVDAAWAGSAMICPEFRTYWPGVEGADSIVFNPHKWLGAQ
FDCSAHFLKNADDLVRTLAISPEYLKTHGHDGIVNYSEWSVPLGRRFRALKIWFLIRTYG
IEGLRQRIRNHVAWSRQLHDALAQEPDFEIVTPPMWSLWTFRYAPDGATDLDALNLELVN
RINDDGRIYLTQTRVDGALVIRFQAGAFETTEADIMRAHDVITELARGLT
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgaactggaccgatttcgcatcctggggccgcaaggtcgccgactgggcgcaggattat
cacctcaccgtgggcgaacgcccggtgcgcgcgcagaccaaacccggcgatatgctgaac
gccctgcccgaaaccccgccggaacacggcgaggggatggaggcgatctttgccgatttt
gaggaaaaggtgatgcccggcatcacccattggcagcacccgcgcttctttgcctatttc
gcctccaacgccgccgcgccctcggtgctcgcagaattcctgacctccgccatcgcgccg
caatgcatgctctggcagacctctccggcagcaaccgagatggaaactcggatgatggat
tggctacgccaatcccttggcctgcccggggaatttcgcggcgtcattcaggacagcgct
tcctccgcgacccttgccgccgtcctgaccatgcgcgaacgggccttgaactggcagggc
aatcaacaagggctcgcgggccagcccaccttgcgtatctattgttcggcggaggtgcac
acctcggtggaccgtgcgatctgggttgcgggcatcggtcaggccaacctcgtgcgcgta
cccatcaagggcgactggcgcggcatggatcccgccgcgcttaacgcagccattgaggcc
gacaaggccgcgagccttcaccccgctggcgtcatcctctgtgtgggcggcaccggcacc
gctgcaacagatcccatcgcggactgcatcaaagtggctcaaaatcacgggctttacacc
catgtggatgccgcttgggccggttccgcgatgatctgcccggaatttcgcacctattgg
cccggcgttgagggcgccgacagcatcgtcttcaatccgcacaaatggctcggcgcgcag
tttgattgctcggcgcatttcctgaagaacgcggatgatctggtgcgcaccctcgccatc
agcccggaatacctcaagacccacggtcacgacggcatcgttaactattcggaatggtcg
gtgccgttgggtcgccgcttccgcgcgctgaagatctggttcctgatccgcacctacggc
attgaaggattgcgacaacgcatccgcaatcacgttgcatggtcgcgccagcttcacgac
gcgcttgcgcaagagccggattttgaaatcgtcaccccgccgatgtggtcgctctggacc
ttccgctacgcgcctgatggggccacggaccttgatgcgctgaaccttgagctggtcaac
aggatcaatgacgacggccgcatctacctcacccagacccgcgtcgacggcgcgctggtg
atccggtttcaagcgggcgcgtttgaaacaaccgaggctgacatcatgcgcgcccatgat
gtgatcacagaacttgcacgaggactgacctga

DBGET integrated database retrieval system