KEGG   Rickettsia monacensis: RMONA_03085Help
Entry
RMONA_03085       CDS       T03824                                 

Gene name
phbA
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rmc  Rickettsia monacensis
Pathway
rmc00071  Fatty acid degradation
rmc00072  Synthesis and degradation of ketone bodies
rmc00280  Valine, leucine and isoleucine degradation
rmc00310  Lysine degradation
rmc00362  Benzoate degradation
rmc00380  Tryptophan metabolism
rmc00620  Pyruvate metabolism
rmc00630  Glyoxylate and dicarboxylate metabolism
rmc00640  Propanoate metabolism
rmc00650  Butanoate metabolism
rmc00900  Terpenoid backbone biosynthesis
rmc01100  Metabolic pathways
rmc01110  Biosynthesis of secondary metabolites
rmc01120  Microbial metabolism in diverse environments
rmc01130  Biosynthesis of antibiotics
rmc01200  Carbon metabolism
rmc01212  Fatty acid metabolism
rmc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rmc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RMONA_03085 (phbA)
   00630 Glyoxylate and dicarboxylate metabolism
    RMONA_03085 (phbA)
   00640 Propanoate metabolism
    RMONA_03085 (phbA)
   00650 Butanoate metabolism
    RMONA_03085 (phbA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RMONA_03085 (phbA)
   00072 Synthesis and degradation of ketone bodies
    RMONA_03085 (phbA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RMONA_03085 (phbA)
   00310 Lysine degradation
    RMONA_03085 (phbA)
   00380 Tryptophan metabolism
    RMONA_03085 (phbA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RMONA_03085 (phbA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RMONA_03085 (phbA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RMONA_03085 (phbA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rmc04147]
    RMONA_03085 (phbA)
Enzymes [BR:rmc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RMONA_03085 (phbA)
Exosome [BR:rmc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RMONA_03085 (phbA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CEO17015
UniProt: A0A0B7J231
Position
complement(516743..517921)
Genome map
AA seq 392 aa AA seqDB search
MTKPVYITYAKRTAFGSFMGSLSTTAAPMLAAHLIKDIMQNSKIDPALVGEVILGQVITG
GSGQNPARQTLIHAGIPKEVPGYTINKVCGSGLKSVALASNSIMTGDNEIVIAGGQENMS
LGMHGSYIRAGAKFGDIKMVDLMQYDGLTDVFSGVFMGITAENISKQFNISRQEQDEFAL
SSHKKVAKAQLVGIFKDEILPIEVTIKKTTSLFDHDETVRPDTSLEILSKLRPAFDKNGV
VTAGNASSISDGAACLMVVSEEALKKHNLTPLARIVSYASAGVDPSIMGTAPVPASKKAL
SKAGWSVNDLEVIEVNEAFAAQSIYVNREMKWDMDKVNVNGGAIAIGHPIGASGGRVLIT
LIHSLRRAKAKKGLVTLCIGGGMGMAMCVEAV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaccggtttatataacttatgcgaaaaggactgctttcggctcgtttatgggt
agccttagtacaacagctgcacctatgcttgctgctcatttaataaaggatataatgcaa
aacagcaaaatcgatccagctttagtaggtgaggtaatccttggacaggtaataacaggc
ggtagtggacagaatccggcaaggcaaactctgattcatgcgggaataccgaaagaagtg
ccaggctatacgattaataaagtatgcggctcaggtcttaaaagcgtagcacttgcatca
aattcaattatgacgggtgataatgaaatagttatagcaggtgggcaggagaatatgtcg
ctcggtatgcacggtagctatatcagagcaggagctaaattcggcgatattaaaatggtt
gatctaatgcagtatgacggattaaccgatgtattttcaggagtatttatgggtattact
gccgaaaatatctcgaaacagtttaatattagcagacaagagcaggacgagtttgcctta
agctctcacaagaaagtggctaaagcacagctagtaggaatttttaaagatgaaatctta
cctatcgaagtaacgattaaaaaaactactagtttgtttgatcatgatgaaacagtaaga
cctgataccagccttgaaattctgagtaaattacgtcctgcttttgataaaaacggtgta
gttacggcgggtaatgcttcctctattagtgacggtgcggcatgtcttatggtagtttcc
gaagaagctttgaaaaagcataatttaacgccgctagctcgtattgtttcttatgcttca
gccggtgttgacccaagcattatgggtactgcccctgttcctgcatccaaaaaagcttta
agtaaagcaggttggagcgttaatgatctggaagttatcgaggttaatgaggcgtttgct
gcccaaagtatttatgtaaaccgtgaaatgaaatgggatatggataaggttaatgttaac
ggcggagcaatagcaatcggtcatccgatcggtgcaagcggtgggcgtgtacttattact
ttaatacacagtttacgaagagctaaagctaaaaaaggcttagttactttatgtatcggt
ggcggtatgggtatggctatgtgtgttgaagcggtttaa

DBGET integrated database retrieval system