KEGG   Rickettsia monacensis: RMONA_03905Help
Entry
RMONA_03905       CDS       T03824                                 

Definition
(GenBank) Putative pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
rmc  Rickettsia monacensis
Pathway
rmc00790  Folate biosynthesis
rmc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rmc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RMONA_03905
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rmc04147]
    RMONA_03905
Enzymes [BR:rmc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     RMONA_03905
Exosome [BR:rmc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RMONA_03905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a Peptidase_M15 COX15-CtaA
Motif
Other DBs
NCBI-ProteinID: CEO17167
UniProt: A0A0B7IZ16
Position
637497..637793
Genome map
AA seq 98 aa AA seqDB search
MSWWHYTLEDEPYKDQYFNFDIEKTMTVLSEKRCIPCKGGVPPLEKKEIDKLLTELQNEW
QVNELGHYKKYKFSNFIKAMEFANRITEIAEQKHIIPI
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
ttgagttggtggcattatacacttgaagatgagccttataaagatcaatattttaacttt
gatatagaaaaaactatgacagtattaagcgagaaaagatgcataccatgtaagggtgga
gttccgccacttgagaaaaaagaaattgataaattattgactgaattacaaaatgagtgg
caagtgaatgaattagggcattataaaaaatataaattttctaattttataaaagctatg
gaatttgcaaataggataactgaaattgcagagcagaagcacatcatcccgatttaa

DBGET integrated database retrieval system