KEGG   Rickettsia monacensis: RMONA_08590Help
Entry
RMONA_08590       CDS       T03824                                 

Gene name
metG
Definition
(GenBank) Methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
rmc  Rickettsia monacensis
Pathway
rmc00450  Selenocompound metabolism
rmc00970  Aminoacyl-tRNA biosynthesis
rmc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rmc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    RMONA_08590 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    RMONA_08590 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rmc01007]
    RMONA_08590 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rmc03016]
    RMONA_08590 (metG)
Enzymes [BR:rmc01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     RMONA_08590 (metG)
Amino acid related enzymes [BR:rmc01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   RMONA_08590 (metG)
Transfer RNA biogenesis [BR:rmc03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    RMONA_08590 (metG)
 Prokaryotic type
   Other AARSs
    RMONA_08590 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 Dpoe2NT
Motif
Other DBs
NCBI-ProteinID: CEO18062
UniProt: A0A0B7J1M6
Position
complement(1347126..1348652)
Genome map
AA seq 508 aa AA seqDB search
MNNTYYITTPIYYVNDVPHIGHAYTSVASDVIARFMRLRSFDVMFLTGTDEHGQKVEKAA
INKNIDPQKFTDQTSESFRHLMTAMHISNDDFIRTTENRHKEVVAVFWQKLLDNGTIYEG
FYEGWYAVRDEAFYDESELTEGKLAPMGAPVEWVKEPSYFFNLSKWQDKLLEFYEANPDF
IRPISRRNEVISFVKSGLKDLSVSRTTFNWGIKVPNNEKHVIYVWLDALANYISVLDYPD
EQSNYGKFWPANLHVVGKDILRFHAVYWPAFLMAAEIPLPKTIMAHGWWTNEGQKISKSL
GNTIDPIKLIDEFGVDQVRYFLMREVTFGADGNFARSNLITRINSELSNKIGNLLQRTTA
FVYKNNDGKVPLLTQDVIDKIYELPILKNASKFAEQNILLMDKTEINKILENIINLAEEA
NIYIDSEAPWNLKKTDPDKMLEVLYTLLEVLRYIAIMLLPFIPSSANKMLDQLGVNKEER
LFKHLVRDYALTAGSNILEPTIIFPKFE
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatacttactacattactacccctatatattacgttaacgatgttccccatatc
ggtcatgcttatactagtgttgcaagtgacgtaatcgctcgtttcatgcgacttcgcagt
ttcgatgtaatgtttttaacaggtactgacgaacatgggcagaaagtagaaaaagcagct
attaataaaaatattgacccacaaaaatttaccgatcagacatccgagagttttcgtcat
ctgatgactgctatgcatatttccaatgatgattttatcagaacaacggaaaacaggcat
aaagaagttgtagctgttttttggcagaaattactagataacggcactatttatgaaggt
ttttatgaaggatggtatgcagtgcgagatgaggctttttatgatgaatcagagctaact
gaaggtaagcttgcaccgatgggtgctccagttgaatgggttaaagagcctagctatttc
tttaatctttcaaaatggcaagataaattgcttgagttttatgaagcaaaccctgatttt
atcagacctatatcaaggcgtaacgaagtaattagctttgttaaatcaggtctaaaagat
ttatccgtatcacgtactactttcaattggggtatcaaagtcccaaataatgaaaaacat
gtaatttatgtttggcttgatgcactggctaattatatttcggtccttgattatcctgat
gaacaaagtaattacggtaaattttggcctgctaatttacatgtagtcggtaaagatatc
ttacgttttcatgccgtttattggcctgctttcttaatggctgcagaaatcccgctgccg
aagacaattatggctcatggttggtggacgaatgaggggcagaaaatctctaaatctctt
ggtaataccattgatccgattaagttaattgatgaatttggcgttgatcaagttaggtat
tttctgatgcgtgaagtaacttttggtgcggacggtaattttgctcgtagtaatttaatt
actcggattaatagcgagctatcaaacaagataggtaatttattacagcgtactacagct
tttgtttataagaataatgacggcaaagtaccgctacttacgcaagatgtcatagataaa
atatatgaactaccgattttaaaaaacgcaagtaaatttgccgagcagaatattttattg
atggataaaacagagattaataaaattcttgaaaatattattaatttggccgaagaggca
aatatctatattgatagcgaagcaccttggaatttgaaaaaaaccgatcctgataagatg
ctagaagtgttatacactttactagaagttttacgttatattgcaataatgcttctgcct
tttataccaagttcagcaaataaaatgcttgatcagttaggggtaaataaagaagaacgt
ctatttaagcatttagtacgtgactatgctttaacggcgggtagcaatattttagaacct
accataatatttccaaagtttgaataa

DBGET integrated database retrieval system