KEGG   Rhopalosiphum maidis (corn leaf aphid): 113548256Help
Entry
113548256         CDS       T06065                                 

Definition
(RefSeq) D(4) dopamine receptor-like
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
rmd  Rhopalosiphum maidis (corn leaf aphid)
Pathway
rmd04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rmd00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    113548256
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rmd04030]
    113548256
G protein-coupled receptors [BR:rmd04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    113548256
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srv 7TM_GPCR_Srsx 7tm_4
Motif
Other DBs
NCBI-GeneID: 113548256
NCBI-ProteinID: XP_026804843
Position
1
AA seq 438 aa AA seqDB search
MHVDQDWHNVVKITCVGFLAVIGAFLNIVVLVMFYKKPSLRSPSNRFVGSLIASDLLSST
VLGPLLVSGIKTINKALTVFVATSTIFSILVIAMDRYTAVLSPLHYATNVTRQKSVLVIG
TVWSISAALTSPILFKDLLAYEQFSVAMLEKTHGLVLLVIAFLVPCAALILVYFKMYVAA
HKNSLRTRKHSVCMEPEMSRRNSNAIFSALLFREESRAMKTSMMVLSTFLFSWTPLFVHV
SIVRLPEEVVYTCALSAATLNPLVYVFRNDAFRKEMLRVVCSRKRLRESAAAKASTGYQQ
HRLMTAHQSDSVSVHSFRMSSVECQHSFDSVTPPPADFVATYNPINGSERCTRYESVTFR
LAQRRCQYCSRQSSDSSLSSNYPLLVNKNRSLSEPNTPKHHNNNENRIVMFKVAEVETKR
NKLQRMMAIDTDCPSTRV
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgcacgttgaccaggactggcacaatgtggtcaaaattacgtgcgttgggtttttagcc
gtaattggagcttttttaaacattgttgtactagttatgttctacaagaagccttcactc
agatctccgtcaaacagattcgtcggtagtttaattgcttccgatttgctgtcatcgacc
gtccttggtcctttactggtatccggtataaagaccatcaataaagctcttacggtgttc
gtcgcaacatctacaatattttcaatactagttattgcgatggacagatacacagcagtt
cttagtcctcttcattacgcgacaaatgttactaggcaaaaaagtgttctagtcataggt
acggtttggagcatatcagctgcgttgacatcaccaatattatttaaggacttgttagca
tatgaacagttttctgtggcgatgctggaaaaaacacacggtctggtgctgctagtgatt
gcatttttagttccttgtgctgcccttattttggtgtacttcaaaatgtacgtggcggct
cacaagaacagtctgcggacgcgcaagcacagcgtgtgcatggagccagagatgtcgcgg
cgcaactcgaacgccatcttctcggcgctgctgttccgggaggagagccgggccatgaaa
acgtccatgatggtgctgtccacgttcctgttcagctggacgccgctgttcgtgcacgtg
tccattgtccggttgccggaagaggtggtgtacacgtgcgccctgtccgcggccacgctc
aacccgcttgtgtacgtgttccggaacgacgcgttccgcaaggagatgctgcgcgtggtc
tgtagccgtaaacggttgcgtgaatcggccgcggccaaggcgtccaccggttaccagcaa
caccggctgatgacggcccaccagtccgacagcgtgtcggtgcacagtttccgaatgtcg
tccgtcgagtgccaacactcgttcgactcggtcacgccgccgcccgccgactttgtcgcc
acgtacaatccgataaatggatcagagcgatgtacacgttacgagagtgttacattccgg
ttggcccagcgccgttgccaatactgcagcagacagagttcggactcgtcgttgagtagt
aattatccattgctggttaacaaaaaccgttcattgagcgagccaaacacaccgaaacat
cataacaacaacgaaaaccgaattgtcatgtttaaggtagcggaagtggaaaccaaaagg
aacaaactacaaaggatgatggcgatagacactgattgtccatcgactcgagtttaa

DBGET integrated database retrieval system