KEGG   Rhopalosiphum maidis (corn leaf aphid): 113550169Help
Entry
113550169         CDS       T06065                                 

Definition
(RefSeq) vacuolar protein sorting-associated protein 41 homolog
  KO
K20184  vacuolar protein sorting-associated protein 41
Organism
rmd  Rhopalosiphum maidis (corn leaf aphid)
Brite
KEGG Orthology (KO) [BR:rmd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rmd04131]
    113550169
Membrane trafficking [BR:rmd04131]
 Endosome - Lysosome transport
  Tethering complex
   Hops complex
    113550169
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin Vps39_2 Vps39_1 TPR_7 WD40 TPR_2 zf-RING_5
Motif
Other DBs
NCBI-GeneID: 113550169
NCBI-ProteinID: XP_026807662
Position
1
AA seq 837 aa AA seqDB search
MTNQSDEKSDIETAEEVEPKLKYVRLTNDVQTILTKDGVSYLAAHPKFLCIGTNWGSIHL
LDFEGNIVNNRQLRPHTVAVNQISIDSRGEFIATCSDDGNVFVYGLYTTEDSQEVSLGRC
VKSVAIDPLYHKSGNYRRFITGDDRLMLHERTFLGRTKSVFLCDVEGVVHNMRWHNRFVA
WASNIGLRVYDIISRCSLGLIKWDKRNNIIPSTYRCNLTWKDSGTLLVGWVDTVRICGVK
RRLQRLKDVPEYIVEPLSMFRIDYFISGIGPLNHNQLVILCYSKEKDENEKAMRPQLYVV
EAKESKYVELCTDNLSLRDFQDFGCNDYALESLVVENLFVIVSPKDIVVANPCDADDRIE
WLIEHNKYAEAMDIVNSKNIVLNRNSRISVGKKFLDHLLFVEEYVEAGQLTAELFGNDKK
LWQEEIFKFAQVHQLRQVSAYIPRGEITLDPHIYEMVLYEYLKLEPEGFLKIVKQWSPSL
YNVSAVTNALIEHLIVNSSSELLEALAILYTHSGKFDKALGAYLKLNHKGIFQLITKQNL
YPLIHNMIEDLMQLDCEQTIKILLEKDTVPIDVAVEKLQDNKLYLYMYLDALEKKDTRVL
ARRNLHKDLVSLYAAFAREKLLPLLKRSNNYSIALALDECKRLEYYPEMVYLLGRMGNTK
DALNLVMSQLQDIEQAIEFCKDQNDVDLWHDLIGLSLDQPNFLKVLLRKIGTYVDPRILI
RRIGKRTQIPGLKDALVKMMTDYNLQVSVEEGCTKIVVSDCFDLHERLYNVRRKGCSVDE
QHLCSACQKCIVGQNTLGNVLIFCCQHVFHEQCIPADGLETACIICTDSRTKQTAFQ
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatcaatccgatgaaaaatctgacatagaaacagctgaagaagtcgaaccaaaa
cttaagtatgtacgtcttactaatgacgttcaaactattttaaccaaggacggtgttagt
tatcttgctgctcatcccaagtttttatgtattggtactaattggggttctattcattta
ttggattttgaaggtaacattgtaaataatcggcaactacgtccacatacagtagcagtt
aatcaaataagtatagacagtcgtggtgaattcattgctacttgttcagatgatggtaat
gtatttgtttatggtctctatacaacagaagattctcaggaggtctcattaggccgttgt
gttaaatctgtcgcaatagatccattgtatcataaatccggcaattatcgacgtttcatt
actggagatgatcgtcttatgcttcacgagcgaacttttcttggacgtacaaaatctgtg
tttttgtgtgacgttgaaggagtcgtacataatatgaggtggcacaatcgttttgtagca
tgggcttcaaatataggtctcagagtatatgatataatctctcggtgttcacttggcctt
attaaatgggataaaagaaacaatataatacctagtacttacagatgtaacttgacatgg
aaggatagtggaacattacttgttggttgggttgacacagtaaggatttgtggtgttaaa
cgtcgactgcaaagacttaaggacgttcctgagtatatagtagaaccactatctatgttt
cgtatagattactttatttctggtataggaccacttaatcataatcaattagtaatatta
tgctattcaaaagaaaaagacgaaaacgaaaaagcaatgagaccacaattatatgtagtt
gaagcaaaagaatcaaagtatgtagaattgtgtactgataacttgtctttacgcgatttt
caagatttcggttgtaacgattatgcccttgaaagtttagtagtggaaaatctattcgtt
attgttagtccaaaagatatagttgtggctaatccgtgtgatgcggacgacagaattgaa
tggcttattgaacataacaaatatgccgaagcaatggatatagtaaattctaaaaatata
gttttaaatcgaaattcccgaatatctgtaggcaaaaaatttttagaccatttattgttc
gttgaagaatatgtagaagctggacagttgactgccgaactttttggaaacgataaaaaa
ctttggcaagaagaaatatttaaatttgcacaagtacatcaacttcgtcaagtaagtgct
tacataccaaggggtgaaataactctagatcctcatatttatgaaatggttttatacgag
tacttaaaactggaacctgaaggatttttaaaaattgtaaaacaatggtcgccatcacta
tataatgtgtctgctgttacaaacgcactaattgaacatttaatagtaaactcaagttct
gaactattagaagccttggctattttatatactcattctggcaagtttgacaaagcatta
ggagcgtacttgaagctgaaccacaagggtatattccaattgattaccaaacaaaatctg
tacccacttatacacaatatgattgaagatttaatgcagttagactgtgaacagacgatc
aagatacttttagagaaggacaccgtgcctatcgacgtagccgtggaaaaattgcaggac
aataagctctacttgtacatgtatttggacgccctggagaagaaagacacaagggtgttg
gccagacgaaatttacacaaggacttggtgtcgctgtatgcggcatttgcacgggagaag
ttgttgccgctactgaagcggagtaacaattattctatcgccttggcactagatgagtgc
aagcgcctcgagtactatcccgaaatggtgtatctgctgggtcgaatgggtaacaccaag
gacgcactgaacttggtcatgtcgcaattacaggacatcgagcaggccattgagttttgt
aaggaccaaaacgacgtcgacctgtggcatgacctgatcggcttgtctttggaccaacca
aatttcctcaaagtgctattgcggaagatcggcacgtacgtggacccgcgaattctgatc
cgtcggattggcaagcgaacgcagatcccaggtttgaaagacgcgcttgtcaagatgatg
actgattacaatttgcaggtatctgtggaagagggatgcacaaaaatcgtcgtgtccgat
tgcttcgacctgcacgaacgactgtataacgtccggaggaaagggtgtagtgtagacgag
cagcatttgtgcagcgcttgccaaaagtgcatcgtaggccagaacaccttgggaaacgta
ttaatattttgctgtcaacacgtgttccacgaacaatgtatacccgcagacgggttggag
acggcgtgtataatttgcacggacagccggacgaaacagacggcgttccagtga

DBGET integrated database retrieval system