KEGG   Rhopalosiphum maidis (corn leaf aphid): 113554832Help
Entry
113554832         CDS       T06065                                 

Definition
(RefSeq) heat shock protein 70 A1-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
rmd  Rhopalosiphum maidis (corn leaf aphid)
Pathway
rmd03040  Spliceosome
rmd04141  Protein processing in endoplasmic reticulum
rmd04144  Endocytosis
rmd04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:rmd00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    113554832
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113554832
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    113554832
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    113554832
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rmd01009]
    113554832
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rmd03041]
    113554832
   03009 Ribosome biogenesis [BR:rmd03009]
    113554832
   03110 Chaperones and folding catalysts [BR:rmd03110]
    113554832
   04131 Membrane trafficking [BR:rmd04131]
    113554832
   03051 Proteasome [BR:rmd03051]
    113554832
   03029 Mitochondrial biogenesis [BR:rmd03029]
    113554832
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rmd04147]
    113554832
Protein phosphatases and associated proteins [BR:rmd01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     113554832
Spliceosome [BR:rmd03041]
 Complex B
  Other components
   Prp19 complex
    113554832
 Complex C
   Prp19-CDC5 complex
    113554832
Ribosome biogenesis [BR:rmd03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    113554832
Chaperones and folding catalysts [BR:rmd03110]
 Heat shock proteins
  HSP70 / DNAK
   113554832
Membrane trafficking [BR:rmd04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    113554832
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    113554832
Proteasome [BR:rmd03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    113554832
Mitochondrial biogenesis [BR:rmd03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    113554832
Exosome [BR:rmd04147]
 Exosomal proteins
  Proteins found in most exosomes
   113554832
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C StbA Hydantoinase_A DUF3153
Motif
Other DBs
NCBI-GeneID: 113554832
NCBI-ProteinID: XP_026814690
Position
2
AA seq 643 aa AA seqDB search
MVGKTAIGIDLGTTYSCVGIWQHGKVEVIANDQGNRTTPSYVAFTDTERLIGDGAKNQVA
MNPVNTVFDAKRLIGRRFDDEKTQADIKHWPFKVINDCGKPKIQVEFKGEPKVFAPEEIS
SMVLTKMKETAEAYLGREVTDAVITVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAA
LAYGLDKNLKGERNVLIFDLGGGTFDVSVLQIDEGSIFEVKSTAGDTHLGGEDFDNRLVC
HLAEEFKRKCKKDVHSNPRALRRLRTAAERAKRTLSSSSEATIEIDALMEGVDFYTRVSR
ARFEELCADLFRSTLQPVEKALADAKLDKGDIHDVVLVGGSTRIPKIQSLLQNFFCGKPL
NLSINPDEAVAYGAAVQAAILSGDTSSAIQDVLLVDVTPLSLGIETAGGVMTKIVERNST
IPCKQTQTFTTYADNQPAVTIQVFEGERAMTKDNNLLGTFDLTGIPPAPRGVPKIEVTFD
MDANGILNVSAKDNSSGRSKNIVIKNDKGRLSQAEIDRMLSEAERYKEEDERQKAKIAAK
NQLESYVFSVKQALDEAGDKLTESEKNTGKQECDAVVQWLDNNQLADKEEYEYKLKEIQK
SCSALMMKIHGAGQPGGAPPGAQGFPGAQGFPGSRGPTVEEVD
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atggtcggaaagacggcgatcggtatcgacctgggtaccacctattcttgtgtgggtatc
tggcaacacggaaaagtagaggtgatcgccaacgatcaaggtaacaggaccactccgagt
tatgttgcgttcacggacaccgaacggttgatcggcgacggggccaagaaccaggtggcc
atgaatcccgtgaacacggtgttcgacgccaaacgtttgatcggacgtcgtttcgacgac
gaaaagacgcaagcggacatcaaacactggccgttcaaagtgataaacgattgcggtaag
cctaaaatccaagtggaattcaaaggcgaaccgaaagtgttcgcgccggaagagatcagt
tcgatggtgctgacgaaaatgaaggagacagcggaagcgtacttgggccgcgaagtgacg
gacgccgtgatcacggtgccggcgtactttaacgattcgcagagacaggcgacaaaggac
gcgggcgtgatagccggcctgaacgtgatgcgaataatcaacgaaccgacagctgcggct
ttggcgtacggtctggacaagaacctgaaaggagagaggaacgtgttgatattcgatctg
ggcggcggaacgttcgacgtgtcggttctgcagatcgacgagggttcgatattcgaagtg
aagtcgacggcgggcgacacgcacttgggcggcgaagacttcgacaaccggctggtatgt
catttggcggaagagttcaagaggaaatgcaaaaaagacgtacattccaatccgagggcg
ttgaggcggttgaggacggccgcggaacgggccaagagaacgttgtcgtctagctcggag
gccaccatagagatcgacgctctgatggaaggtgtggatttctacacgcgagtttcccgg
gcccgtttcgaggagttgtgcgcagacctgttcagatcgactctgcaaccggtggaaaag
gcgttggcggacgccaagttggacaagggagacatacacgacgtggtgctcgtgggcggt
tccacgaggatcccgaagatccagagtctcctgcaaaactttttctgcggcaaaccgctc
aacctgtccatcaatcccgacgaagccgtagcctacggcgccgcagtacaggcggccatc
ctgagcggcgacacgagttctgcgattcaagacgtgttgctcgtggacgtcaccccattg
tcgctgggcatcgagaccgcgggcggagtgatgaccaaaatcgtcgagcgcaattccact
attccttgcaagcaaacccaaacgttcacgacgtacgcggacaaccaaccggccgtcacc
atccaggtgttcgaaggggaaagggccatgactaaggacaacaacctgttgggaacgttc
gacctgaccggcatacctccggctcccaggggtgtacccaagatcgaggtgacttttgat
atggacgccaacggcattttgaacgtgtcggctaaggataacagctctgggcgctcaaag
aacatcgtcatcaagaacgacaaaggtcgcctgtctcaagccgaaatcgatcgtatgctc
agcgaagcggaacggtacaaagaagaggacgaacgacagaaggccaagatcgcggccaag
aaccagttggagagctacgtgttcagtgttaaacaagcgttggacgaggccggcgacaag
ttgaccgaatccgagaaaaacaccggcaaacaggaatgcgacgccgtcgtccagtggttg
gacaacaatcagttggcggacaaagaagagtacgagtacaaactcaaggaaatccaaaag
agttgctctgctctcatgatgaagatacacggtgcgggacaacccggtggcgcgcctccc
ggtgcgcagggtttccccggtgcgcaaggtttccccggctctagaggacctaccgtcgaa
gaagtcgattaa

DBGET integrated database retrieval system