KEGG   Rhopalosiphum maidis (corn leaf aphid): 113555124Help
Entry
113555124         CDS       T06065                                 

Definition
(RefSeq) autophagy-related protein 16-1
  KO
K17890  autophagy-related protein 16-1
Organism
rmd  Rhopalosiphum maidis (corn leaf aphid)
Pathway
rmd04136  Autophagy - other
rmd04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:rmd00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113555124
   04136 Autophagy - other
    113555124
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rmd04131]
    113555124
   03029 Mitochondrial biogenesis [BR:rmd03029]
    113555124
Membrane trafficking [BR:rmd04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    113555124
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    113555124
Mitochondrial biogenesis [BR:rmd03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    113555124
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG16 WD40 ANAPC4_WD40 eIF2A
Motif
Other DBs
NCBI-GeneID: 113555124
NCBI-ProteinID: XP_026815258
Position
2
AA seq 541 aa AA seqDB search
MDWKAVICQQLESRNSRETTTFQNLINFYNKIYDSSLLLRAQNIQLESQIIRGNTGGDFV
YSEKISALEQKLLVQQEELTKLHRRRGENAQMIIDLNAKLQLTEQTLASKNHSLTEHMKL
VASLRAEISLYQKNNSELKQLNQVLKDEHQALQLAFTKLEEKLRAFQDENRELVVRLMTY
KSKDAEKLNEENDHLVRKRNAIMQNELKEAANDMRGVTAECLTTAVSNSIGPIMASPCAM
PSKATIRFDAHDGVVSAVKWSPVDRMVATGGEDRKVKLWDVSKGVAECKGMLIGSNAGVM
SVEFDSTGGQIVAASNDLASRVWTVNDQRLRHTLTGHCAKVMAAKFMGEPNKVVTGSHDR
TLKIYDLRIRACVETKFAMSSCNDLVTSETVGTTIMSGHFDKRIRFWDTRTEKPHTEIEV
QGRVTSLDLSRDCNYLLSCVRDDTLRLVDLRTNKIINTFEADGFKVGCDWTRAVFNLEYD
HVAVGSSEGSVFIWAVSNPEKPLVVLKNEHSAPVTAVSWHQFTNNVASVDRSRRAVVWAD
V
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggattggaaggcagttatatgccaacaattggagagcagaaactccagggagacaact
acctttcaaaacctgatcaatttctataacaaaatctatgacagttcacttttgttgaga
gcgcaaaatattcagctagaatctcaaattatacgtggtaatactggtggtgattttgtt
tactctgaaaaaatatcagctttagaacaaaaattgcttgtgcaacaagaagaattgacc
aaattacatcgtagacgtggagaaaatgctcaaatgattatagatttaaatgcaaaatta
caattgactgagcaaacacttgcaagcaaaaaccacagtttgactgaacatatgaagtta
gttgctagtttgcgagctgaaatatctttataccagaaaaataactctgaactaaaacaa
ttaaatcaagttctcaaagatgaacaccaagcactgcagttggcttttactaaacttgaa
gaaaaattacgtgcatttcaagatgaaaacagagaactcgtggtcaggttaatgacttat
aaatctaaggatgccgagaagttgaatgaggaaaacgaccatctagtcagaaaacgaaat
gctattatgcaaaatgaacttaaagaagcagctaatgacatgcgtggtgtaaccgcagaa
tgcttgacaactgctgtaagcaatagtattggtccaattatggcatctccgtgtgccatg
cctagcaaagctaccattcgatttgacgctcatgatggtgttgtaagcgctgtgaagtgg
agtccagtagatcgaatggtggcaactggtggagaagaccgtaaggtgaagctgtgggat
gtgtctaaaggtgttgctgagtgcaaagggatgttgattggaagcaatgcaggtgttatg
tcagttgagtttgacagcacaggtggacaaattgtagcagcatctaatgatttggcatcg
cgtgtttggacagtaaatgatcaacgacttaggcacacgttgactggacattgcgccaaa
gtgatggctgccaagttcatgggtgaacccaacaaagtggtgaccggcagccacgaccgc
acgctgaagatatacgatctacgcatcagggcatgcgtcgagaccaagtttgccatgtcc
agttgcaacgacctggtcacatcggagactgttggcacgaccatcatgagcggccatttt
gacaagaggatacgattctgggatacgaggaccgagaagccacatacggagatcgaggtc
caaggacgggtcacgtctttggacttgtccagagattgtaattacctattgagctgtgtc
cgggacgacaccctgcggctggtcgatctcaggacgaacaaaataatcaacacattcgaa
gctgacggatttaaagtgggttgtgattggacaagagctgtgttcaatttagaatatgat
catgtggccgttggatcctctgaaggctcggtgttcatatgggccgtgtcaaatcccgaa
aaaccacttgtagtattgaagaacgaacacagcgcaccggtgacagccgtgtcttggcat
cagtttaccaacaacgtggccagcgtagatcgatccaggagggcagtggtatgggcagac
gtttga

DBGET integrated database retrieval system