KEGG   Rhopalosiphum maidis (corn leaf aphid): 113555241Help
Entry
113555241         CDS       T06065                                 

Definition
(RefSeq) titin
  KO
K12567  titin [EC:2.7.11.1]
Organism
rmd  Rhopalosiphum maidis (corn leaf aphid)
Brite
KEGG Orthology (KO) [BR:rmd00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rmd01001]
    113555241
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rmd04131]
    113555241
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rmd04812]
    113555241
   04147 Exosome [BR:rmd04147]
    113555241
Enzymes [BR:rmd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     113555241
Protein kinases [BR:rmd01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   113555241
Membrane trafficking [BR:rmd04131]
 Others
  Actin-binding proteins
   Others
    113555241
Cytoskeleton proteins [BR:rmd04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     113555241
Exosome [BR:rmd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   113555241
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 ig Ig_2 Titin_Ig-rpts V-set fn3 C2-set_2 C1-set Ig_4 SH3_9 SH3_1 SH3_2
Motif
Other DBs
NCBI-GeneID: 113555241
NCBI-ProteinID: XP_026815437
Position
2
AA seq 19528 aa AA seqDB search
MNQQQQQKQITTTSTSSMSMGQRSVNRTEQQVTRQFTQTTQRQVHEGFIVHQSTPKFGND
AAPPVFEQIFKNARFAQGGNAVFEGKVTGIPKPFVSWTRKGAPLLESYKYKMTYDQQTGN
VVLTINQIGPGDEGEYTCSARNQYGEAICSVFIQPEGHTVQIPQGTYGSQRVQQTQNTLY
TNNYSNIDEDFKVDTFEYRLLREVSFRQSVTKRYLGEEDVKFTSSAHQGPVVAPQVLQKP
RNSKLVEGSNATFTVKVSTAKDTRLTWFKNGQRLVNGPKHQINFTNQIATLYIPQVNCED
SGHYTLLVENPQGCVVSSAYLAIEPMQIAYDRTEDKENVITKTHNKLESIEVVEGKMLAP
NFVRVCGDRDVTEGKLTRFDVRVTGKPYPEVSWYINGQQIKDDATHKILVNESGDHGLMI
TNVSQADAGQVVCVARSKSGETSFQCNLGVIEKELVVAPKFVQRFTPLNISEGETVTLSV
RAVGTPVPRITWQKDGVNISEQPGMVSVWTEGGGSVLEIARATPTDAGWYQCTAQNTAGS
TATRARLNIIRKPRPEDFSEDRRLRLPKPTRVIEPEPEPEPEVVFLKHVERAKYHTPRPE
EDKIYPPPRFIVPLANITQQEDGRIHFEARIEPIGDPTMVAEWFVNGYPLQASSRAMTLL
NYGFIALDLLSIISDDAGEYTCRVTSSSGTAQSTAVLKVEGRDEIDKSSQYPDSLKYIEQ
LEDYSKYQRSDSYDEVQPLPPTLVKSLHDMGDLQEGRNAHFEAQLNPVSDPTMKVEWYKD
GKPITASSRITTIFNFGYVSLNIMHLRAEDSGEYTLRAINRWGEIISTSTLNVIAHSSIT
GDLGYPEQQRYIDQTEALEQSYLQQKNQEYKISAPESIAPPQFKTPIKDQQNIKEGGFAH
FEARLEPLGDSTLQVEWLKDGKPVEASSRMTVFFNFGYVALTIKYVTVFDIGTYTCRAFN
NLGDASTSATLTVLTKKDVVQDSQHPGGLERFQYLEDSRKNKRKAEEETVITQKPRFLGP
LKGTNKIAEGQRAHFEVRVEPQNDVTMKIEWYFNGKVIMSANRIQTYHDFGYVALDILGV
RAEDSGTYVVVARNALGEAQLSATMQVEVRSSIDTSTMHRGVVEKAPYLESKKFTEPQYD
IEEISKSRPIFIQPLSDPAPLNEGKNVHLECRLEPMGDPTMRVEWFQNGKPVTVGSRFRT
YYDFGYVALDIIHVTSIDSGEYTVRATNHLGSAHTSACVNVLCRSDILTESQNEYALEQI
QMLEDASRYQKMTIEEESIMQGPQFTKPLHNIQTSEGTNVHLECRLKPVGDPTMKIDWLV
NGRPVKTGHRFRPAYDFDYVALDLLSVYPEDSGVYTCQARNEMGEAVTSSSVKVIAKQNL
ILDSQHPHGLEKIQYLEDSARYKKAEMIEESVKIRPRFLTKPKNVENLKEGQHAHFECKL
EPVTDSNLEVQWFKNGKPIIIGHRFRPIHDFGYVALDIIDVIEEDSGTYTCRAVNLLGVD
ETNAHLTCRSSSHIVTETQNEMGLEQIQYLEEKSRYHRREDIEETTTQAPIFTTSLKHCD
IKEGQRAHFECRLIPVSDNTMKVEWFHNNVPIKFGSRFTETNNFGFVALDILQCLPEDSG
TYTCRATNWLGQSITSGNLNVQSRKSIYLESQHEDALGRLAQLENSNRYQRQSIIEDVVT
QAPVFTQPMRDITMIESQPAHFEARLIPVGDDKLKVEWLRNGIPIQASNRVSTMHDFGYV
ALNLKYVYPEDSGTYTCRAINDLGQAVTSATLNVHSKASLQLESQHEAALDKLRQLEDSS
RYKRVEQKEVEVTEAPKFIVPLNGTESLIEGQSAHYECRIEPYPDHTLQLEWLHNGKPLQ
TGHRFRTTYDFGFASLDVLSALPEDSGEYTCRAINKLGRAESSVKLSVQSRASIISDTQH
QGALNKIQYLEDDSRFKRAAAEDVLMTEKPQFGRPLKNIEHLPEGRSVHLEATLIPVNDP
TMKVEWFRNGIPIPQGHRFKTVYDFGFVALDVLYAYPEDSGTYMCKAKNVAGEAVTTCIV
TVDSKSGLQLDTLDEDRLKKIKQLEAYERPTAQEAVFELQKPVFLTPLNSLELLKEGEHA
HLETRIEPINDADLKIEWFVNGVAIKTGHRFKTTHDFGYVALDILYAYAEDSGTYMCKAT
NKKGEAVNTCQINVASRRSIYLETQHPDGLEKIRELEAQGRPAKLEIDEPPPTAPSLTDL
WGTTEVAEGKTAHFECQVKPIHDSKLKVEFFHNDKPLGSASRFHTTYDFGYISLDIGHVV
PEDAGKYTVKATNELGQATSNINLLVQGGGSIILDSQRPEGLEKIKELEMAVPFKRADYS
EPISKQRPMFTQPLQNIDSINEGQTAHFECRLIPIGDSSMTVEWFRNEKPLETSSRITKT
YDFGYISLDISHVRDEDNGVYSCKATNALGEAVSTASMRVRTKSDIQLESQHPEGLKKIV
ELERGQEPLKREEAERSFEKPIFTQLLTGPSELIEGQHAHFECRVVPVGDPTLRFEWYVN
GVELKMGSRFHVTNDFGFVTLDISSTVAEDSGVYTCKAINRAGEAVSSTSMKIKHRSSII
HEPLQPDAWEKIQLKEAEMNKVPEMFIDTRPQQAPVFTSHLQNQDRLAEGQHVHLEAQVE
PRADPNLRIEWFKNGVALTTGSRIRSTFDFGLVTLAINSLRPDDTAIYTCKATNILGEAV
STCTLKISDSHWLISNTLHPESLSKIEDLEKPHAGRVEGPEPVFESPVFISHLNNWECKE
GNDVHFECQVEPSKDPTLKIDWFVNGKPLQSAARFKSAYDFGFVTLDIHHAYSEDSGIYT
CRASNSKGQAVTTGTLKCTGLQGIHLDTQHPQGKTGLEKVQKVEDNLASKYQRQTSLPEA
TFPKPIFVVPLEAEFILAESKPLHLEAQVEPKNDPNLKIEWYFNGKVLDLGSRFKTNNDF
GFISLDLTDVYERDQGVYTCKAYNHSGETYTSTTVYCSSNKGLIEHTQHPKGEEGLEKIQ
SLEESLQRQKQGITDKETGHAPVFTSQFKDLGFLSEGEIAHYEASLTPVGDQKMVVEWFY
NGNAIEASHRIRTIYAFGMVVLEILGTKIADTGTYTCKATNDYGSAEMSVTLECVERITG
QKPKFTSQIQTLVGLKDGDSAHFECTLIPVNDPDLKVEWFHNGKPLLHKNRVKMISDFGF
VVMDIAYIQNHDSGEYICKASNKYGEDITKATIQYSGKGGVYLDSLQPTSLARIQELENA
TGQPVGFASSPVSEAPKFTTQLVDITNLKEGQSAHFEARVTPVNDPNLVVEWYFNGEKLQ
HGHRFRTFHDFGIVILDILYCYEENSGVYECRAFNKAGTDTTKANLRCSSKTNLILDSQL
PQGMEGGLEKIQTLEDLTLRVKDEKVSVENRQAPMFTEPLSNIDSLREGESAHFEGRLTP
VDDPNLKVEWFWNGKPLKAGSRFRTFCEFGFVILEISPVYPEDSGEYSCRASNHYGEAVT
TASMKVQGKRSIIVESQLPKGMDTTIDRIAELEGLGKSRAPIETEDDLGRAPEFITTPAD
LSLSENSLAHFECRLVPSNDASMTVTWFHNGKVLSAGSRIKTINDFGFVILEVAGVYIRD
SGLYTCKATNKHGEATVTCKLQVKGRQGIVLEPQLPNTFRSGTKSIQKLEENMYKREEIL
AEDEKPNPPRFTVELKDALDVQEAKSVHFECRVEPVNDSTLRIDWFFNGKPFATGSRVHV
INDFGFISLDMDYVYSRDSGEYICRATNKWGTAFTKAKLTCIAKQNVILESQLPEGMSGE
KLKALEQGPVQEKKIHDEIEAMPPKFLSQIESTTVEEASSVHFETRVEPKNDPKLRVEWY
RNGKPLPSGHRYKSIFDLGFVSLDILSMYSEDSGEYICRAVNDHGEAITKAMVTCKQLPT
ILLQNQVPKGMKKSEALTQMEAAIKKYTSEIHLTIDDLYEVEKKQPPRFVTQIKDQLSLV
EMESTKFECQLAPVGDPNMKVEWFLNGKPLRHKNRFNPIYDFGYVAMNFGWIYPEDSGEY
VCRATNLYGQDETRATIKTSGKPGIIYDSQLPKGMKSIEKIREMEASWQVTPEMKEEEEK
RREPPQFVSKPEPVTVCEGDWARFCCRVTGFPRPRVMWLVNGNTVVNGMRYKLNYDGMWH
LDIPKTRQYDHGKVEVIARNACGETRVETMLIVNSRHDDYRGVLKNSPRPWYDSDLVQYQ
RDLKENELEKVFTDRASNVQNVDYSNMIISTVGDQMKQKQLNDSKPEWTETVKQKKNEDY
YNKLSKLEGDQVIKEARIREANHQVSIAGEKLKTTKNMSKNYEESLVRDKKEELMPWQTT
KLLKARGDQSPQIIPDPSESSVHGKEIHVAKQQQTQKEIQGDKEIRRKITATETTEVEHT
RKNQERVVQGKVEPSKPPIFTTKIQPCRAFEQDQARFEVEFDGEPLPTIKWYREDFLIQN
SPDFQIHTFSTKSILVIRQVFMEDSGVFAVIAENRGGKAKCSANLLVEERKQVGRKGPGP
PSFLSTMQGSVVKAGQLVRFDVKISANKPLDVYWLKNGKKISQDIRYKTVDEDNQYTLLI
IESVTEDSGTYECVAINNSGEARCEAQLVVQPLEQKDKPKSKPSGKEQAPTITQPLSGQV
IHEGQPVTFSCKISGQPPITIKWQKGDKVIKPSKYFRMTQDGETVSLHISEVFPEDEGTY
KCLVSNAGGQAVLSANLKVIVPENQDIAPTLSPMRDVIVPEGNAAQFRTQVSGQPSPSVQ
WFREGILIPETPDFKMMYEGNMAVLLITSTYEEDSGVFTCRATNSAGQVETSAKLTVKRQ
RGVTYKTGTFDDKGVVDSIQLNQGLGKTKEIGLKTSIKNIKTDKKGIETNDNLLPWRKGI
LIDRIRKTSVEAKSLITENVFIEPTEIGDLITVTQEGTFIYTYVTEQIFTLIQNKIDTKD
VEKAKQIINQVLVKKMKQGDIVSLNENDKNDIVGEVTNKLTQLYTTKVNNKSLAKDILNK
VLTRTMEKEQIIQPYTSEQQKQDEKFVTTTQMILKNKKQKETSQTSEELIKQNKTKIIKQ
DIKSEDKILNQKNQFYFGEQQHENYEIVPDEYKPKLKTENIENIETKSQLIKNLDYNTRP
WLINPNVEKTCSKNDYSPKHEDTLKNEKETTNENLPEKVKTKHINPWTEEKINLRKLETS
KLDENSITTNNKPKRREERNELKEMKDKKTSIPWTEENVKLKKTSTEKQSLTKKTVEDIT
LKPTKNYNNKDQLNNENDQIHKDIDEKETKPIKEVVNAPLAQISNKTQKKSGAPWTEETV
TLKKTKTQKQPLAKESVEEVTLKPIKKPLVEDIPLSEETPMTETTEIVETVVEKGRRRRV
RKIKTDGKEEVEETDEVVEEKPTIENVEDMPVEDVPTEPQRKPSVPWTEETVTLKKTKTQ
KQPLAKESVEEVTLKPIKKPLVEDIPLSEETPMTETTEIVETVVEKGRRRRVRKIKTDGK
EEVEETDEVVEEKPTIENVEDMPVEDVPTEPQRKPSVPWTEETVTLKKTKTQKQPLAKES
VEEVTLKPIKKPLVEDIPLSEETPMTETTEIVETVVEKGKRRRVRKIKTDGKEKVEETDE
VVEEKPTIENVEDMPVEDVPTEPQRKPSVPWTEETVTLKKTKTQKQPLAKESVEEVTLKP
IKKPLVEDIPLSEETPMTETTEIVETVVEKGRRRRVRKIKTDGKEEVEETDEVVEEKPTI
ENVEDMPVEDVPTEPQRKPSVPWTEETVTLKKTKTQKQPLAKESVEEVTLKPIKKPLVED
IPLSEETPMTETTEIVETVVEKGRRRRVRKIKTDGKEEVEETDEVVEEKPTIENVEDMPV
EDVPTEPQRKPSVPWTEETVTLKKTKTQKQPLAKESVEEVTLKPIKKPLVEDIPLSEETP
MTETTEIVETVVEKGKRRRVRKIKTDGKEKVEETDEVVEEKPTIENVEDMPVEDVPTEPQ
RKPSVPWTEETVTLKKTKTQKQPLAKESVEEVTLKPIKKPLVEDIPLSEETPMTETTEIV
ETVVEKGRRRRVRKIKTDGKEEVEETDEVVEEKPTIENVEDMPVEDVPTEPQRKPSVPWT
EETVTLKKTKTQKQPLAKESVEEVTLKPIKKPLVEDIPLSEETPMTETTEIVETVVEKGK
RRRVRKIKTDGKEKVEETDEVVEEKPTIEEIEDMPVEDVPTEPQRKPSVPWREKTVTLKK
TKTQKQPLAKESVEEVTLKPIKKPLVEDIPLSEETPMTETTEKVETVEEKGRRRRVRKIK
TDGKEEVEETVEVVEEKPTVEEVVHKPTIEEIEDMPVEDVPTEPQRKPSVPWREETVTLK
KTKTQKQPLAKESVEEVTLKPIKKPLVKDIPLSEETPMTETTEIVETVEEKGRKRRVRKI
KTDGKEEVEETVEVVEEKPTVEEVVHKPTIEEIEDMPVEDVPTEPQRKPSVPWREETVTL
KKTKTQKQPLAKESVEEVTLKPIKKPLVEDIPLSEETPMTETTEIVETVEEKGRRRRVRK
IKTDGKEEVEETVEVVEEKPTIENVEDMPVEDVPTEPQRKPSVPWREETVTLKKTKTQKQ
PLAKESVEEVTLKPIKKPLVEDIPLSEETPMAETTKIVETVEEKGRRRRVRKIKTDGKEE
VEETVEVVEEKPTVEEVVHKPTIEEIEDMPVEDVPTEPQRKPSVPWREETVTLKKTKTQK
QPLAKESVEEVTLKPIRKPLVEDIPLSEETPMTETTEIVETVVEKGRRRRVRKIKTDGKE
EVEETDEVVEEKPTIENVEDMPVEDVPTEPQRKPSVPWREETVTLKKTKTQKQPLAKESV
EEVTLKPIKKPLVEDIPLSEETPMAETTEIVETVEEKGRRRRVRKIKTDGEEEVEETVEV
VEEKPTVEEVVHKPTIEEIEDMPVEDMPTEPQRKPSVPWREETVTLKKTKTQKQPLAKES
VEEVTLKPIKKPLVKDIPLSEETPMTETTEIVETVEEKGRRRRVRKIKTDGKEEVEETVE
VVEEKPTVEEVVHKPTIEEIEDMPVEDVPTEPQRKPSVPWREETVTLKKTKTQKQPLAKE
SVEEVTLKPIRKPLVEDIPLSEETPMTESTEIVETVVEKGRRRRVRKIKTDGKEEVEETD
EVVEEKPTIENVEDMPVEDVPTEPQRKPSVPWREETVTLKKTKTQKQPLAKESVEEVTLK
PIKKPLVEDIPLSEETPMTETTEIVETVEEKGRRRRVRKIKTDGKEEVEETVEVVEEKPT
VEEVVHKPTIEEIEDMPVEDVPTEPQRKPSVPWREETVTLKKTKTQKQPLAKESVEEVTL
KPIKKPLVEDIPLSEETPMTETTEIVETVEEKGRRRRVRKIKTDGKEEVEETVEVVEEKP
TIENVEDMPVEVVSTEPQRKPSVPWREETVTLKKTKTQKQPLAKESVEEVTLKPIKKPLV
EDIPLSEETPMTETTEIVETVEEKGRRRRVRKIKTDGKEEVEETVEVVEEKPTFEDVEDM
PVEDVPIEPQRKPSVPWREETVTLKKTKTQKQPLAKESVEEVTLKPIKKPVVDDIPLVEK
VTDYDNINVDKHIVQDVVDMNTGNVVVDDHPIIKIRFLKHEDMLREDATNKPDAIVCAQK
VISIPKEKVKKKKKHVQLNEDMNQEKEFSPDDEVSALNDEELPCSNVSDAKDLLGILKST
DDVLTDYNIALKVDEFPTDISLKSKNITEQKIPKKLLSEKLELPWRRGRKDTDTDVVGDD
IKDDTHSLTPKKEQLNVVEVKTLQPKSLDVENKPLFATIKLKKASPKKTKDMEPLAVPKV
QLKSHLYRVELNTNEHFPTISLLEPVFVDNGVLSRNYAEAMKIKKTKPKKLVLPELEPVI
LEKYEPTDFHYDKKETPQTHPSLPIQPLKKKILDEETPKKLVIGKGKIPTQNDDEEKVLL
KKIPQKPVEEKVDIPKPIEKPQFKPEPDLKPSEDKDFTLEPFKPIPVGESFEEGEPTPIK
NDSSPDIEMPTKKPKYIRKKIKKEEEPISDKKIIPGTPKPVPSVEDNDINLKYKQGKPEP
EIPEEIKLKPFLIEKPTVTTEPEGIDLGKPEPFEYPRDDELVKPQYLRSKPEKKMKKKKP
VKTVDHQITTDDNDGTSQPLPIVKEKPVLEEMVTVNVKPVKVVSVELDNKPLLATIKLKK
APSKSKSDVDHVKIPKVLLKSHLKNIEYNTHEHFPTISLLEPVFVDNGVLSRNYAEAMKI
KKTKPKKLVLPELEPVILEKYEPTDFHYDKKETPQTQPSLPIQPLNKKILDEETPKKLVI
GKGKIPTQNDDQEKVLLKKIPQKPVEEKVDIPKPIEKPQFKPELDLKPSEDKDFTLEPFK
PIPVGESFEEGEPTPIKNDSSPDIEMPTKKPKYIRKKIKKEEEPISDKKIIPGTPKPVPS
VEDNDINLKYKQGKPEPEIPEEIKLKPIPIKKPLDNKEIDDDGVGKPKPFMSDLPKIDIN
SKSKKSPLPKSISVDSPLQDLEIVSIKRSEEVPEQKVTENETVAPYFIEKVQPLVAEHEK
PTAFTCSVGGVPSPEVKWYRDDRELQTTDVYEIIVYENTSTLRISKPTEEQAGVYVCQAT
NSAGISTCTALLVVLDSEEIGEAPIFMEPIKPRKVRGKKSIQLRCIVKGIPIPEIIWCRE
NEEIISDDDEYITSFDSKTGEAILTLVNPIDVDRSTYLARAVNIHGKSECMAHITFEKEE
YGEAPKFVERLKPKVVKANETTVLTCLVKGVPSPTVVWCRDDEEITPDDSHLLIYIPETG
ESKLTIVHPDDIDESTYTVNATNKFGRAECRANLIVQKDEIGEAPTFVQPVKPKIAKLNE
ITELKCTVRGTPNPLVIWCRGNEEIIPDESHLITYHQETGESILTILNPSEIDETIYTIN
AVNKYGQAQCRANLIIQKDESGEAPMFIEPIKPKIAKANASTELNCLVRGIPTPTVVWFR
GDVEIIPDNIHSITFIPETGESKLIISKVTEVDQNTYTVKATNKYGRAQCRANVIIQEDV
FGVAPTFVEPIKPVLAKPDQTTVLRCLVTGNPVPTIVWCRGKDEIVPDDMHTIQFIPETG
ESTLTIEKAATIDETHYSVEAINKFGRARCRANLVLEKYDTGIAPAFVVPIKPKAVKPTE
SVELSCVVSGTPMPTVVWCRGDEQLMPDESHIISYTPETGESKLTICNATELDVNDYTVK
AVNDFGAAQCRANLIIDEIVDEIPKSCEEAPCITKPLQPVIAKKDSCVTLDVHFRGTPEL
KVRWFHNGKDITDKKTFVRTLTITETTTVITIKKITKKTTGRYEVVVTNNRGEAKTSTTV
SIDDVDETIEKDETTVGKTPYFETELQTETIWEDEEEKEKKTTMCLVVKVKGTPKPKILW
YESGKEITPNEDFQIEEHDEGVSLLTIKKRPTESVREITCEATNELGTVATRTLVVSGIK
GTKAYRKPSWVTQMEELREQLQAFQSLPSFVNELKDERAVENETIVFECQFSGNPIPVII
WYHDDKIVRNSSNVQVKITDTKTTLTIKRATKEDEGVYICKANSNLGEAKNKAKLYVKKL
GEETFTATEEEVEEKEVEEVKKTKKTKKKTIKKKHKKESESFDETEIKESTTSKTVEGKP
LLPEREPLSTSETISDETVREIRGPEFIHAKPIEEPALFTALKIRKPTVVNEVEQVLDQV
ELAEFGPAECPLRELATIDVLTRHGISIEQVIEEYTSGQFPALRTAPAQSAMVHLIEREG
YTSLVADVFTKESTIPETVNEVFKAFMTMVELKHSTLEEIITYLMPEDFQTSTWDLEHAS
QITTDDTITETADISESINILVNEVKKKTRSTKRLVKTSEESLSIENEQVKKVMDYSNIK
ITDNTIVELSEDKPIKTEKCIKQNKNIEDISKGEDEEEEEIITKETKIIKINKVKRSNIG
KEIIPEETTYEFNVEKYPAICPTVLKTSKTLNETIAQQEAVELSTDINNIPEKAQIRITT
RSAAESIITKDEEKEETRKEALEIKKHQANSAFELNESFSTDHPDAQSPLEEIVKTFEFK
PCLAINDVIPKESITINEIYPNQSLGKGIDYKPKNKEAKVTVISHSQKVVTESIASTKEG
EIKQLLMPQKKKATQDYVEHESINVVEVNEAHTESQLIDDFKPTPVKSSVKYPLHEQLVV
SESHSEIQPENYYPEIIVPTEVAEQLIVPSNNAITAFQIESSEKEAEYNHSKSPNEYKAD
ISIIPEKYIEVSESIIQEKETKLEKEKVPDKSFAVSDIILQSSIIVNSINQEENEEKFNT
HLPQSHTAKLTINNANKVSSSSVIEINEAESDLNILVIPETKQIESSIIGLEVTEIIPKE
TESNFTSQSALEILPVTSFTENNSCIVTETTVDDYSTDLLSNLNYKAFEAKPKFEELEAK
QISQINVQENNIPLDETSKPISVKLETSFYPIQSITVEQTVATEQEQFLPLNVQQELHNS
VSSPSHSLQVVVIEEITPENCVTQIEETYKNNNQNASKIAQISFVDDQCIIVKEVSTYES
ETSLSLDSKPENVKAVPVFTGYDVAETLEIISNDAIEKLNIQKYKNNNAKLKHIPYEAIV
SEVTSVNELEDILPNKEKKQLKNVNIKIDEVVGVNITEQPVYEKEKTSIEQKVFISKKAS
TEFVPIEIVDRSEIVTGDYTLDLIQPEVSESHAYHQPSTFESVILYETNISEKEQEMTED
KTPLVCTANKSLIVDEAIEVTEIISDIKPEDISISILPEEKTAKTNIIPFKPLEGQDITT
CENVETVKNQSPLSEVAHISQKPFHSLETSLIILTDSENKLSDFVMPNTKKAETNYSDLD
IPISVVEILTQDKELDFKGQEVPSHTLDKQEIILEECRVTSETMVCSSTSDFDEIIPQSV
YALPSKSTQIAIESIETAHLEKEGDLVDNHIFSERHADFTYEEVKSIQITEQVKLDTKEE
LIIESIPADRKSNTTITGQDVAETFETKVESPIEELKIEFPKEKSAKTIQANEVHSVEVS
EIITQEKESSLDDNKKYNTKKVNIIVEDNSGTYMVTEIFPKEKEIQFIEKSQPIYRYAEQ
DILSHEGLQVNETNISICEKQLSDLEYSTKLGNRVIEPLECIEISEINVQEPEYNLPKLL
HPKMENAVNILNENVGLIINSTVINDKENELKIDKLNTKIATKISNLIGYKVPQKSEKNT
LESVELLKYIKEDEHQASSEHILLEGISTTVVNSQDKELPFEQLTKLTGKSASLEYEMEQ
NLDVTEVCLGESETDLIPIFLPSSHIAASELSETQQVASSFEVTPQNSTHNLCAQSMPSG
ISITPKSTESHSLEVTETLYHETEKPFESVENVLKTCNLTIQVDQNVEITEIVTNESEKP
LDLFDKNRGSEASIVFDENQSVSIEEIETSDDVVPLTKNVPNALSATKQLELQLGIVVTE
VRTEENEIEHETQIQPSLKHVSQILPEKHSLNVTSAIIIEKESILNKSKKEIQQNAQVSS
VYSPMKVVQSEENFIEMSLTNLKTTTPSEIFSESSQIPYDSINQLEIRSFEKESELKLTK
NKKKEMATINMDTINILTTTEIITGEKESIYTPLTKPITKQALIDITESRPVSKAFEVKP
EDITTELQIPNVISCKITPAQEVVHGVVVVEHLGHDKEEKFEGEYKPTLLAANINVEKEK
ETKTITEVTTHEMEGQVKNIDMPTSKNAHIEINSGKEIAEKIEILPNIALGSLNNFVTKT
STALLVQDTFDSIQSTITTTEDKENPFISDLVYQKSKADINIEESNSINITEVIVDDTEG
KYVSPELPLTKNAGKSILPNEVAEASIVLADENLRTFDKFKTKEESANILLETYSNISQT
ETTVQESEIYLEPVKLISNKADITMIPNNSLTITEVITDDYDEKLNIKKEQNPQKIITSL
SKLHGVPQVSETISSITTSNVIIPVIDSNYASVSQSELYDTVMSTEINALEKERLFTQKP
KFENFKAEIKFKEDKSLNVFETVLNDNEKPLKINEPLIKQASLIQPTFDVPTISEHTLIE
TEINLESTIIPKEQMVNISFENNINVQVSEANAIETESDFLTPIQNSETATIPELIPQPV
ANVTEVITSLNVQNFPQPSQTEYSNASAIHSTFNSLLQTKVEISESENKFKKPKSIEEKA
SVKTETLENIIITEPEISEKEGTLEAPRKIDLRHAQISFEEEKSSIIISNIISEDKESEF
TQAQTRKSSIAKITLENLKAITNTEQNVSEKEGTLNIQNPKDETANMTFEDYQSGIIVSN
VIPEWKEEKLKIKNTTYSTATFITDNYESLIQNQQMVNEKEEFTISEEIPESTTASITVE
NEKIGAVVSEIISGEKESEIQTTKARKKSKALISTKELKPLVTTETQLLSNTEEMKLPNK
ISDTSAKIKLDELSHITIQELVPNEKELKMKQINPIQYNITPTYLELLPLESSQTQSEIT
PIKFENEKIVKCTATKGTTQINKSININEDILLESATDLRQEAINRQRASITDIPLSTDD
IMPALHGEQIISTVTQNNIKHTQTKKNQIDDIKTTTVTEINQKKITKKQTIKTVKDGVEN
VEVIESKPEITEIVDEETKPLPEIESLQPEEATLIPDEAISVDIKTTTVIEGGKKKVTKK
QTIKTVKDGVENVEVIESKPEITEIVDEETKPLPEIESLQPEEATLIPDEAISVDIKTTT
VIEGGKKKVTKKKTIKTVKDGVENVEVIESKPEITEVVDEESKPLPEIESLQPEEATLIP
DEATSVDIKTTTVIEGGKKKVTKKKTIKTVKDGVENVEVIESKPEITEIVDEETKPLPEI
ESLQPEEATLIPDEATSVDIKTTTVIEGGKKKVTKKKTIKTVKDGVENVEVIESKPEITE
IVDEETKPIPEIEFLKPEEATLIPDEATSVDIKTTTVIEGGKKKVTKKKTIKTVKDGIEN
VEVIESKPEITEIVDEETKPLPEIESLQPEEATLIPDEATSVDIKTTTVIEGGKKKVTKK
KTIKTVKDGVENVEVIESKPEITEIVDEETKPLPEIESLQPEEATLIPDEATSVDIKTTT
VIEGGKKKVTKKKTIKTVKDGVENVEVIESKPEITEIVDEETKPLPEIESLKPEEATLIP
DEATSVDIKTTTVIEGGKKKVTKKKTIKTVKDGVENVEVIESKPEITEIVDEETKPLPEI
ESLQPEEASLIPDEATSVDIKTTTVIEGGKKKVTKKKTIKTVKDGVENVEVIESKPEITE
IVDEETKPIPDIESLQPEEATLIPDEATSVDIKTTTVIEGGKKKVTKKKTIKTVKDGIEN
VEVIESKPEITEIVDEETKPLPEIESLQPEEATLIPDEATSVDIKTTTVIEGGKKKVTKK
KTIKTVKDGVENVEVIESKPEITEIVDEETKPLPQIESLQPEEATLIPDEATSVDIKTTT
VIEGGKKKVTKKKTIKTVKDGVENVEVIESKPEITEIVDEETKPLPEIESLKPEEATLIP
DEATSVDIKTTTVIEGGKKKVTKKKTIKTVKDGVENVEVIESKPEITEIVDEETKPLPEI
ESLQPEEATIIPDEATSVDIKTTTVIEGGKKKVTKKKTIKTVKDGVENVEVIESKPEITE
IVDEESKPLPEIESLQPEEATLIPDEATSVDIKTTTVIEGGKKKVTKKKTIKTVKDGVEN
VEVIESKPEITEIVDEETKPLPEIESLQPEEATLIPDEATSVDIKTTTVIEGGKKKVTKK
KTIKTVKDGVENVEVIESKPEITEIVDEETKPLPEIESLKPEEATLIPDEATSVDIKTTT
VIEGGKKKVTKKKTIKTVKDGVENVEVIESKPEITEIVDEETKPLPEIESLQPEEATIIP
DEATSVDIKTTTVIEGGKKKVTKKKTIKTVKDGVENVEVIESKPEITEIVDEESKPLPEI
ESLQPEEATLIPDEAPSVDIKTTTVIEGGKKKVNKKKTIKTVKDGVENVEVIESKPEITE
IVDEETKPLPEIESLQPEEATLIPDEATSVDIKTTTVIEGGKKKVTKKKTIKTVKDGVEN
VEVIESKPEITEIVDEETKPLPEIESLKPEEATLIPDEATSVDIITTTVIEGGKKKVTKK
KTIKTVKDGIENVEVIESKPEITEIVDEETKPLPEMESLKPEEATLIPDEAISVDIKTTT
VIEGGKKKITKKKTIKTVKDGVENVEVIESKPEITEIVDEETKPLPEIESLKPEEATLIP
DEATSVDIKTTTVIEGGKKKVTKKKTIKTVKDGVENVEVIESKPEITEIVDEETKPLPEI
ESLQPEEASLIPDEATSVDIKTTTVIEGGKKKVTKKKTIKTVKDGVENVEVIESKPEITE
IVDEETKPIPEIEFLKPEEATLIPDEATSVDIKTTTVIEGGKKKVTKKKTIKTVKDGIEN
VEVIESKPEITEIVDEETKPLPEIESLQPEEATLIPDEATSVDIKTTTVIEGGKKKVTKK
KTIKTVKDGVENVEVIESKPEITEIVDEETKPLPEIESLQPEEATLIPDEATSVDIKTTT
VIEGGKKKVTKKKTIKTVKDGVENVEVIKSKPEITEIVDKETKPIPDIESLQPEEATLIP
DEATSVDIKTTTVIEGGKKKVTKKKTIKTVKDGIENVEVIESKPEITEIVDEETKPLPEI
ESLKPEEATLIPDEATSVDIKTTTVIEGGKKKVTKKKTIKTVKDGVENVEVIESKPEITE
IVDEETKPLPEIESLQPEEATLIPDEATSVDIKTTTVIEGGKKKVTKKKTIKTVKDGVEN
VEVIESKPEITEIVDEETKPLPEIESLKPEEASLIQDEATSVDIKTTTVIEGGKKKVTKK
KTIKTVKDGVENVEVIESKPEITEIVDEETKPLPEIESLQPEEATLIPDEATSVDIKTTT
VIEGGKKKVTKKKTIKTVKDGVENVEVIESKPEITEIVDEETKPLPEMESLKHEEATLIP
DEAISVDIKTTTVIEGGKKKVTKKKTIKTVKDGVENVEVIESKPEITEIVDEETKPLPEI
ESLKPEEATLIPDEATSVDIKTTTVIEGGKKKVTKKKTIKTVKDGVENVEVIESKPEITE
IVDEETKPLPEIESLQPEEASLIPDEATSVDIKTTTVIEGGKKKVTKKKTIKTVKDGVEN
VEVIESKPEITEIVDEETKPIPEIESLKPEEATLIPDEATSVDIKTTTVIEGGKKKVTKK
KTIKTVKDGIENVEVIESKPEITEIVDEETKPLPEIESLQPEEATLIPDEATSVDIKITT
VIEGGKKKVTKKKTIKTVKDGVENVEVIESKPEITEIVDEETKPLPEIESLKPEEATLIP
DEAISVDIKTTTVIEGGKKKVTKKKTIKTVKDGVENVEVIESKPEITEIVDEETKPLPEI
ESLKPEEATLIPDEATSVDIKTTTVIEGGKKKVTKKKTIKTVKDGVENVEVIESKPEITE
IFDEETKPLPEIESLKPEEATLIPDEATSVDIKTTTVIEGGKKKVTKKKTIKTVKDGVEN
VEVIESKPEITEIVDEETKPLPEIESLQPEEATLIPDEATSVDIKITTVIEGGKKKVTKK
KTIKTVKDGVENVEVIESKPEITEIVGEETKPLPEIKSLKPEEATLIPDEATSVDIKTTT
VIEGGKKKVTKKKTIKTVKDGIENVEVIESKPEITEIVDEETKPLPEIESLKPEEATLIP
DEATSVDIKTTTVIEGGKKKVTKMKTIKTVKDGVENVEVIESKPEITEIFDEETKPLPEI
ESLKPEEATLIPDEATSVDIKTTTVIEGGKKKVTKKKTIKTVKDGVENVEVIESKPEITE
IVDEETKPLPEIESLQPEEATLIPDEATSVDIKTTTVIEGGKKKVTKKKTIKTLKDGVEN
VEVIESNPEITEIVDEETKPLPEIESLQPEEATLIPDEATSVDIKTTTVIEGGKKKVTKK
KTIKTLKDGVENVEVIESKPEITEIVDEETKPLPEIESLQPEEASLIPDEATFVDIKTTT
VIEGGKKKVTKKKTIKTVKDGVENVEVIESKPEITEIVDEETKPLPEIESLKPEEATLIP
DEATSVDIKTTTVIEGGKKKVTKKKTIKTVKDGDENVEVIESKPEFTEIVDEESKTLHNL
HSHDVVKPSFTSDIHLSQKPITHIYDDTSLTNDNVPHDDIHSTSPVYISDNHKSDESSID
SLLKEVIDENIEFPLNSTVTDVDDTSLIEQSKIIDNIGTPTFNELEIKEAFMALKPRKKM
SLTDEEEVVNITYIPKQTKPKEVIEQEFSIKAHTYEEEEISMTGNVKLRRKSTVECPKQS
LTINEIEINQINEEDLEKPDEHTEEIPKPADEFPQKTIEEPIIIEECTLDKPSTGILYDD
QSISVITDVKVEPIRKLSIKQEVATVEFTSEKVETKVSEEEQPLEELEVKINPQRKSSHK
KEIKENLVEESSVVVKRPKKKEEKPQEPTEEVISIKEIKETPEEVQPVSETVDIMIEPKR
KPSIEKEEAADEITIEKIETIVQGEEQPSEEVEVKIKPKRKPSLKKDIKEKSPEESSVVV
KRPKKKEAVPQEQEPTEEVFTIKEIKEKPEEIQQLSETVDVKIEPKRKPSIKKEETADEI
TIEKVETIVQEEEQPSEEVEVKIKPKRKPSLKKDIKEKSPEESSVVVKRPKKKEAVPQEQ
EPTEEVFTIKEIKEKPEEIQQLSETVDVKIEPKRKPSIKKEEAADEITIEKFETIVQEEE
QPSEEVEVKIKPKRKPSLKKDIKEKSPEESSVVVKRPKKKEAVPQEQEPTEEVFTIKEIK
EKPEEIQQLSETVDVKIEAERKLSIKKEEAADEITIEKVETIVQEEEQPSEEVEVKIKPK
RKPSLKKDIKEKSPEESSVVVKRPKKKEAVPQEQKPTEEVFTIKEIKEKPEEIQQLSETV
DVKIEPERKLSIKKEEAADEITIEKVETIVQEEEQPSEEVEVKIKPKRKPSLKKDIKEKS
PEESSVVVKRPKKKEAVPQEQEPTEEVFTIKEIKEKPEEIQQLSETVDVKIEPKRKPSIK
KEEAADEITIEKVETIVQEEEQPSEEVEVKIKPKRKPSLKKDVKEKSPEESSVVVKRPKK
KEAVPQEQKPTEEVFTIKEIKEKPEEIQQLSETVDVKIEPKRKPSIKKEEAADEITIEKV
ETFVQEEEQPSEEVEVKIKPKRKPSLKKDIKEKSPEESSVVVKRPKKKEAVPQEQEPTEE
VFTIKEIKEKPEQIQQLSETVDVKIEPKRKPSIKKEEAADEITIEKVETIVQEEEQPSEE
VEVKIKPKRKPSLKKDIKEKSPEESSVVVKRPKKKEAVPQEQESTEEVFTIKEIKDKPEE
IQQISETVDVKIEPKRKPSIKKEEAADEITIEKFETIVQGEEQPSEEVEDKIKPKRKPSI
KKDIKEKSPEESSVVVKRPKKKEAVPQEQESTEEVFTIKEIKDKPEEIQQISETVDVKIE
PKRKPSIKKEEAADEITIEKFETIVQGEEQPSEEVEDKIKPKRKPSLKKDIKEKSPEESS
VVVKRPKKKEAVPQEQESTEEVFTIKEIKDKPEEIQQISETVDVKIEPKRKPSIKKEEAA
DEITIEKFETIVQEEEQPSEEVEDKIKPKRKPSLKKDIKEKSPEESSVVVKRPKKKEAVP
QEQESTEEVFTIKEIKDKPEEIQQISETVDVKIEPKRKPSIKKEEAADEITIEKFETIVQ
EEEQPSEEVEVKIKPKRKPSIKKDIKEKSPEESSVVVKRPKKKEAVPQEQESTEEVFTIK
EIKDKPEEIQQISETVDVKIEPKRKPSFKKEEAADEITIVKEEEQPIEEVEVKLKSKRKP
SFEEESKEKSFDEASVIVKRPKKRLEKPIEVDETDEVFTVKKTLEKPCMLNDEFSETVEF
KIKPKQSSSSYNVDEGTEELFKIDLKPKKELQDIIIYEEESLDFKVKRKPSIQSFSQDGA
ELKIVQEKDVFLKDNNILQEDSHDGEIMFAIRSYIAENEDALDLVEGEKVYVIESNNQDW
WFVKKHLTEEKGWVPSIYLRDETSYMRYVQKKLHEKIDKLPIFQRHASNEKPSAPRFVEK
LQPKHVPDGGTVQFECHVEGNPRPQITWFRQTAIIKPSQDFQIFYDEDNVATLIIREIFP
EDAGTFTCVAKNIAGFASSTTELTVEAPLSDHGSDVTGLSRKSMSRESSLADILEGIPPT
FSRKPKATCTSEHSDVILECRLVAVPEPDIFWHYNGREISITDSIKVNTYSDMHFYVSSI
KINDVLKTQEGIYTVIARNREGEAKMDLVLKVKTGLPEKPQILEPLYDITINEGETAVLS
TQISGEPQPMVEWLKNSKKITDIKTVVTKDGIHSLTINNPTPRDSAKYTVIASNKLGSAQ
TTCFLAVEELPGPQAPLFIERFQEQTVKEKGTITLIAKVTGNPVPIVSWFRNNKPLLASS
KKKEVFDGENIVLEIINADSEEDAGDYKCVATNTFGTATHGARVSVDVPQVKFTQPLSDI
EVDEKQAIYLECETSHTVSTKWQLNGKDLTGMDHRELHQEGRFHRLIIKKSSILDSGKYT
CLVKDQITSCTVVVHDVKAEFVKKLEDVEVKENDCAILEVEVSSETVNVTWHKNGEMLTD
GMKNKIFFEKEGQTRKLIIRSISVHDDGEYTCSLGEQECTAEINVIELAPQIIKKLKDQK
VATGEQVLFEIELTKGDALVKWTKDGKELHLNNNVRLTIDGKRQKLEIVNATKTDTGVYG
CQVHEQTCTAKLTVEEPKASFVKKLPDITLAVQGSDIKLTVELSKPDVPVKWLRSGKVIK
ESDKYEIISEGAVHTLVIKKPTTDDEAEYICTAVNVKTSTKLKVEVKEEPPKINNLPKEY
RLKNGEDLNMNVTFTSTMMPTVEWFINGSVLIKSNRVSYSISESSVSLTITKIEEVDTGV
LTLKLKNIYGETTADMDIVVIKLPGEPGVPDVIEVTDTSVTLHWKPPQFDGNSPIEGYIV
EYHDKDEFMVWHKVQVTDTTHEVINLVTGHEVMFKVAAINCAGIGPASHNTKYVKMASPG
SFTPPVIQEPLSDLSIGMGKSAVLQCVITGKPTPDIKWLKNKTVYKTKTTSFENHVAKLM
IAECNESTPGTYTCQATNGAGTAQTSCKLSVQDVPKIEVHESETSQMIRVRNQWKVKATY
KGYPKPTISWQKNSVPLPVSDKHISVYDDEDEWSSTIAIYSVERPDTGVYTITASNAAGT
ATCNLNLKVIEPAKDDKPSAPQGPMRIKEINSDSVTIEWNKPSDDGGLDISSYQIERCNV
GKMIWSKVADVDHDVSAYSVQKLHEDAEYMFRVCAQNAVGASDFLDSEPVTVKCRYHKPS
APQGPLQITGVTDTSLTIAWLPPFDNGGIAIEDYCVEIKEVDKKAWRKISSTKDLHLKVS
DLKKGSSYDIRIIARNHVGYGKPYQPDEPIVAGKRISFRNGISDETLYVLMGIFPTKSRA
SASPSPPTEFTVSDITSKTVTLHWGLPESNGGSEITGYVIEKQLNTTNKWFKVATLEPTT
MKYCVENLKEKSEYYFKIYAENCIGLSQPVETKLVSLLTHATVPSPPTAPLEVRNLSSNA
VIVEWGVPETDGGAPLLGYNIAIRDEKKTMWMEVGRVDTDVQKFNIKDLQENHRYHIRIL
AKNEVGVSEPLETEEPYTVQKPTDYYESDVEESVMESKPSLTQTSETTTSWLRENNMDAD
ISSYSNAALLKRSEYFFRIWYYARTLFK
NT seq 58587 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaacaacaacagcaaaaacagattaccaccacctccacctcctcgatgtccatg
ggacagaggagcgtgaaccgtaccgaacaacaggtcacgagacaattcacgcagactaca
cagagacaagttcacgaaggatttattgtacaccagtctactccaaaatttggaaatgac
gctgctccgccagtatttgaacagatattcaaaaacgccagattcgcccaagggggaaat
gccgtttttgaaggaaaggttactggtattccaaaaccttttgtctcatggaccaggaaa
ggcgctccgttattggagtcatacaaatacaagatgacgtatgatcaacaaacagggaat
gttgttcttacgatcaatcaaatcggtccaggagatgaaggggaatacacatgttcggcg
cgcaatcaatacggcgaagcaatttgttctgttttcattcaaccagaaggtcatactgtt
caaatacctcaaggcacgtatggttcgcagcgagtacaacaaacacagaatacgctgtat
acaaataattattcgaacatcgatgaagatttcaaagtcgatactttcgaatatcgctta
ctccgtgaagtgtccttcagacagtctgtcaccaaaaggtacctgggtgaagaggatgtc
aaatttacaagcagcgcacaccaaggcccggtcgtcgcaccccaagtgcttcagaaaccg
cgtaattcaaaattagtagaaggatcaaacgctacgtttactgtaaaagtgtcaacagct
aaggatacaaggttgacttggtttaagaacggacagagactcgtaaacggaccaaaacac
caaataaatttcaccaaccaaatcgctacactttatataccacaagttaattgtgaggat
tctggacattacactctgcttgtagaaaacccacaaggctgtgtagtttcttctgcgtat
cttgccatagaaccgatgcagatagcatatgacagaacagaagacaaggagaatgtaata
actaaaactcataacaagcttgagtctatagaagtagtcgagggtaagatgttggcacca
aactttgtgcgtgtttgtggtgatcgtgatgtgactgaaggaaaattgacacgtttcgat
gttcgtgttacgggtaaaccgtatcccgaagtctcatggtatataaatggtcagcaaatt
aaggacgacgcaacgcacaagatattggttaacgaatctggtgaccatggtttgatgata
actaatgtgtcccaagcagatgcaggtcaggtggtttgtgtcgcaagaagtaaatctgga
gaaacttctttccaatgtaatctgggagtcatcgaaaaagaacttgtagttgctccaaag
tttgtacaacgttttacacctttaaatataagtgaaggagaaacagttacgttgagcgtc
agagctgttggtaccccagtaccaagaataacatggcaaaaagatggtgtaaatatcagc
gaacaacctggaatggtgtctgtatggaccgaaggaggtggttcagtattagaaatagca
agagctactccaacagatgcaggttggtatcaatgtacagctcaaaacacagctggatca
acagcaacaagggctcgccttaacatcataaggaaacctcgccctgaagacttctccgaa
gaccgacgtcttaggctgccaaaaccaacacgagtcattgaacctgagcctgaaccagaa
ccggaagtcgttttcttaaaacatgttgagagagcaaaataccatactcctcgaccagaa
gaagataagatttatccaccaccaaggttcattgttccactcgcgaacattactcaacaa
gaagatggtcgaattcactttgaggctagaattgaacctatcggagatccaacgatggtg
gctgagtggtttgtaaatggttacccattacaagcaagttcgagagctatgactttatta
aattacggtttcatagctttggatttgttgagcattatatctgatgatgctggagaatat
acatgtagagtgaccagtagttctggaacagctcaatctactgctgttctcaaagttgaa
gggagagatgaaatcgataaatccagtcaatatccagacagtttaaaatatattgaacag
ttagaagattattccaaatatcaaagaagtgatagttatgatgaagttcagccattacca
cccactttagttaaatcattacatgatatgggtgatttacaagaaggtagaaatgcacat
ttcgaagctcagcttaacccagttagtgatccaactatgaaagtagagtggtataaagat
ggaaaacctattacagcaagttcaagaataacaacaatatttaattttggctatgtttca
ttaaatattatgcatcttcgtgcagaagacagtggagagtatactttaagagctataaac
cgatggggagaaattatcagcacatcaacattaaatgttattgctcatagcagtattaca
ggtgatttaggctacccagaacagcaaaggtatattgatcaaactgaagctttggaacaa
tcttacctacaacaaaaaaatcaagaatataaaataagtgcacctgaaagtattgcacca
ccgcaatttaaaacgccaattaaagatcagcaaaacattaaagaaggtggttttgctcat
tttgaagcaagattagaaccattaggagattcaacgcttcaagtagaatggttaaaggat
ggtaaaccagttgaagctagttcaagaatgactgtattcttcaactttggatatgttgca
ttgacaataaaatatgtaactgtttttgatattggaacatatacttgcagagcttttaat
aatttaggagatgcttcaacatctgctacattgactgttctgactaaaaaagatgtagta
caagatagccaacaccctggaggtctcgaacgattccaatatttggaagattcaagaaaa
aataaacgcaaagcagaagaagaaacagttattacacaaaaacctagatttcttggacca
ctaaaaggaacaaataaaattgctgaaggtcaaagagctcattttgaagttcgagtagaa
cctcaaaatgatgtgactatgaaaattgaatggtactttaatggaaaagtaataatgagc
gctaatagaattcaaacatatcatgattttggttatgtcgctttggatattcttggtgta
agagccgaagatagcggtacatatgtggttgttgcaaggaatgccttaggagaggctcag
ctgtcagctacaatgcaagttgaagttcgttcaagtattgatacatctactatgcatcgt
ggagtagttgaaaaagctccttatcttgaatctaaaaagttcactgaacctcagtatgat
attgaagaaatttcaaagtcaagacctatatttatacaacctttaagtgatcctgcacca
ttgaatgagggtaaaaatgttcatttggaatgtcgtcttgagcctatgggtgatcctaca
atgagagttgaatggttccaaaatggaaaacctgtaacagttggttcaagattccgtacg
tactatgattttggatatgttgctttggatatcatacatgtcacatcaattgactctggt
gaatacactgtgagagctacaaaccatttaggatcagctcatacatctgcctgtgtcaat
gtattatgtcgatcagacattttaactgaaagtcaaaatgagtatgcattagagcagata
caaatgttagaagatgcatcaagatatcaaaaaatgacaattgaagaagaaagtattatg
caagggccacagttcactaaaccattacataatatacagacatctgaaggtacaaacgta
catttggaatgtagattaaaaccggttggggatccaactatgaaaatagattggctggtc
aacggacgtccagtcaaaacagggcataggttccgccctgcatatgattttgattatgta
gcattagatttgttaagtgtatatcctgaagattctggagtgtatacttgccaagctaga
aacgaaatgggtgaagctgttacttctagctcagtgaaagtgattgctaaacagaattta
atattagattcacaacatccacatggtctagaaaaaatacaatatctagaagattcagcg
agatataaaaaagctgaaatgattgaagaatctgttaaaataagacctcgttttttgacc
aaaccaaagaatgtagaaaatttaaaagaaggacagcatgctcattttgaatgtaaatta
gaaccagtcactgattctaacctagaagttcagtggtttaaaaatggaaaaccaatcatt
attggccatcgctttagacctatccatgattttggatatgtagccttagatatcatagat
gtcatcgaagaagattctggaacttacacatgccgtgctgttaatttacttggtgttgat
gaaacaaatgctcatctaacatgcagaagttcatcacatattgtaacagaaactcaaaac
gaaatgggtctggaacaaattcaatatcttgaagaaaaatctagataccacagaagagaa
gacattgaagaaacaaccactcaggctccaattttcactacttcattgaaacattgtgat
attaaagaaggccaacgagctcattttgaatgtagattaattccagtatctgataacacc
atgaaagttgaatggttccacaataatgttccaattaaatttggatctcgatttactgaa
accaataactttggatttgttgcattggatattcttcaatgtttacctgaagattctggc
acatatacatgtcgtgcaactaactggctaggacaatctataacatcaggaaatctcaac
gttcaatcgagaaagtcaatttatttggaatcacaacatgaagatgcattaggtcgttta
gctcagcttgaaaactcaaaccgttatcagcgtcaatcaattatagaagatgtagtaaca
caagctccagtatttactcaacctatgagagatattactatgattgaaagtcagcctgct
cattttgaagcaagattaataccagtgggtgatgataaattaaaagtagaatggttaaga
aatggaatccctattcaagcatctaatcgtgtatcaacaatgcatgattttggttatgtt
gctcttaatcttaaatatgtttatcctgaggattctggtacttacacatgcagggctata
aatgatttaggacaagcagttacctcagccacactgaatgtgcattctaaagcttctctt
caattggaaagtcaacacgaagcagcattagataaattaagacagctcgaggattctagt
aggtacaaacgagtagaacaaaaagaagtggaagttactgaagcgcctaagtttattgtg
ccattaaatggaactgaaagtttgattgaaggtcaaagtgcccattatgaatgccgtata
gaaccttatcctgatcatacactacaattagaatggttacataatgggaaaccattacaa
acaggacataggtttagaacaacttatgattttggttttgcgtcattggatgttttatca
gctttaccagaagattctggagaatatacatgtagagctattaataaacttggaagggct
gagtcatcagttaagctaagtgttcaatctcgagcatcgattattagtgatactcaacac
caaggagctttgaacaaaatacagtatttggaagatgactctagatttaaaagagcagct
gctgaagatgttctaatgacagagaaaccacaatttggacgacctcttaagaatatagaa
catcttccagagggacgaagtgtacatcttgaagctacattaataccagttaatgaccca
actatgaaggttgagtggtttagaaacggaataccaattcctcaaggccacagatttaag
acagtttatgattttggatttgttgcattggatgtactttatgcttatcctgaagattca
ggtacatacatgtgcaaggccaaaaatgttgcgggagaagcagtcactacttgtattgta
acagtcgattctaaatctggtcttcagttagacacattggatgaagatagattaaagaag
attaaacaacttgaagcttatgaaagacctacagctcaagaagctgtatttgaacttcaa
aaaccagtattcctcacacctcttaacagtcttgaattactaaaagaaggagaacacgct
catttagaaactcgaattgaaccaattaatgatgctgatttgaaaattgaatggtttgtt
aatggagtagcaattaaaacgggtcatcgtttcaagactacacatgattttggatatgtt
gcattagatattttatatgcatatgctgaagattccggtacttatatgtgtaaagccacc
aataaaaaaggagaagcagtaaatacttgtcaaattaatgttgcctctcgtagaagtatc
tacttagaaacgcagcatcctgatggattagaaaagattcgtgaacttgaagctcaaggg
cgcccagcaaaacttgaaattgatgagcctccaccaacagcgccatcattaaccgatcta
tggggcactactgaggtagctgaaggaaaaacagcccactttgagtgtcaagttaagcct
atacacgattctaaattgaaagttgagttcttccataatgacaaaccacttggatctgct
tctcgtttccatactacatatgactttggttacatatctttggatattggccatgttgtt
cctgaagatgctggaaagtacaccgttaaagctaccaatgaattgggtcaagccacttca
aatattaatttattagttcaaggaggtggaagtataattttggactctcaaagacctgaa
ggattagaaaaaataaaagagttagaaatggctgtacctttcaaacgtgcagattattca
gaacctatatcaaaacaaagaccaatgttcacacaacctttacaaaatattgacagcata
aatgaaggacaaacagctcactttgaatgtcgtctcatcccaataggcgattcatcaatg
acggttgaatggtttagaaatgaaaaaccattagaaacaagttcaaggattacaaaaaca
tatgactttggttatatatctctagatatttctcatgttagagatgaagataatggggta
tatagttgtaaagccacaaatgctcttggagaggcagtttcgacagcctctatgagagtt
agaacaaaatctgatattcagttagagagtcaacatccagaaggtcttaaaaaaattgtt
gaattagaacgcggtcaagaaccgttgaagagagaagaggcagaaagatcatttgaaaaa
ccaattttcacacaacttcttacaggtccttcagagcttattgaaggtcaacatgctcat
tttgagtgtagagttgtaccagtaggtgacccaacattacgttttgagtggtatgttaat
ggagtcgaactaaaaatgggttcaagattccatgtaacaaacgattttggttttgtaaca
ttagacatcagctcaactgttgcagaagattccggagtttatacatgtaaagcaattaac
agggctggagaagctgtttcttccacttccatgaaaataaaacatcgttcttcaattatt
catgaaccattacaacctgatgcatgggaaaaaattcagcttaaagaagcagaaatgaat
aaagttcctgaaatgttcattgatactagaccacaacaagcacctgtttttacttcacat
ttgcaaaatcaagatcgtttagctgaaggtcagcatgttcatttagaagctcaagtagaa
cctagagcagatcctaatcttcgaattgaatggttcaaaaatggagtcgcattgactact
ggttcaagaatccgtagcacttttgattttggtttagtcacattagcaataaatagtttg
agaccagatgatacagctatctatacatgcaaagcaacaaacattttgggtgaagctgtt
tcaacttgtacattaaaaatatcggatagtcattggttaataagtaacactttacaccct
gaatctctttcgaaaattgaagatttggaaaaaccacatgctggacgagttgaaggacca
gagccagtttttgaaagtcctgttttcatttctcatcttaataactgggaatgtaaagaa
ggaaatgatgttcattttgaatgccaagtagaaccttccaaagatccgactttgaaaatt
gattggtttgtaaatggaaaaccacttcaaagtgcagctagattcaagtcggcctatgat
tttggttttgtcacattagatatacatcacgcatactcagaagattctggaatatacact
tgtagagctagtaatagcaaaggtcaggctgtaactactggaacattaaaatgtacaggt
ctccaaggcattcatttagacacacaacatccacaaggaaaaactggattagaaaaagta
caaaaagttgaagataatcttgcttctaaatatcaacgtcaaacatctttgcctgaagca
actttcccaaaaccaatatttgttgtacctcttgaagctgaattcatattagctgaaagt
aaaccactgcatttggaggcacaagttgaacccaagaatgaccccaatctcaaaattgaa
tggtactttaatgggaaagtacttgatttaggatcacgctttaagacaaacaacgatttt
ggttttataagtttggatttaactgatgtttatgaacgagatcaaggagtgtatacctgc
aaagcatataatcattctggagaaacatatacttcaacaactgtatattgcagtagcaac
aagggattaatcgagcatacacaacacccaaaaggagaagaaggtttggaaaaaattcaa
agtttagaagaatctctacaaaggcaaaaacaaggaattacagataaagagactggacat
gctcctgttttcacttcacaattcaaagatcttggatttttaagtgaaggtgaaattgct
cattatgaagcttcattaacacctgttggtgatcagaaaatggttgttgaatggttctac
aatggaaatgctattgaagctagtcatcgtattcgtacaatatatgcatttggaatggtt
gttcttgaaattcttggtactaaaatagctgatacaggaacttacacttgtaaagcaacg
aatgattatggatctgcagagatgagtgttacactagaatgtgttgaaagaataactggt
caaaaaccaaaattcacttctcaaattcagactctagttggcttaaaggatggagattct
gcacattttgaatgcacattaataccggtcaatgacccagatttaaaagtagaatggttc
cacaacggtaaaccattattacacaaaaatcgcgtaaaaatgatttccgattttggattt
gtcgtcatggatatagcatatatacaaaaccacgattctggagaatatatatgtaaagca
agcaataaatatggcgaagatataactaaagccactatccaatactctggaaaaggtggt
gtgtatttagattcactgcaacctacttccttagctagaattcaagaattagaaaatgct
acaggacaaccagttggatttgcatcatctcctgtatcagaagctcctaaatttacaact
caattggttgacataacaaatttgaaagaagggcaaagtgcccactttgaagctcgagtt
acaccagtgaacgatccaaatcttgttgttgaatggtatttcaatggtgaaaagctacaa
catggtcatagatttagaacattccatgattttggtatagtaatattggatatattgtat
tgttatgaagaaaattctggtgtatacgagtgtagagcatttaataaagcaggaactgat
accactaaggcaaatctacgttgtagctccaaaactaatttgatcttagattcccaactt
cctcaaggaatggaaggaggattagaaaaaattcaaactcttgaagatttaaccctcaga
gttaaagatgaaaaagtttctgtggaaaaccgtcaagctccaatgtttactgaaccatta
tccaatattgatagtttacgagaaggtgaaagtgcacattttgaaggtcgtcttacacct
gttgatgatcctaacttaaaggtcgaatggttctggaatggaaaaccattaaaagcaggt
tctagattcagaactttctgtgaatttggttttgttatattggaaatatctccagtatat
cctgaagattctggagaatattcatgccgagcttccaatcattatggtgaagctgttact
acagctagcatgaaagttcaaggaaagagaagtatcattgtggaatcgcagcttccaaaa
ggaatggacactactattgatagaattgcagaacttgaaggtcttggaaaatcaagggca
cctattgaaactgaagacgatctgggaagggcaccagaattcattacaactccagctgat
ctaagtttgtcagaaaattcgttggctcattttgaatgtagacttgtaccatcaaatgat
gctagtatgacagttacttggttccataatggcaaagtgttatcagcgggatcacgcata
aaaacaattaatgattttggatttgttatccttgaagtagctggtgtttatattcgagat
tctggtctatatacttgcaaggctaccaataaacatggagaagcaacagtaacgtgtaag
ttacaagttaaaggccggcaaggtatagttttagaacctcaattgcctaacacattcaga
tctggcacaaaaagtattcaaaagcttgaagagaatatgtataaacgggaagaaatattg
gctgaagatgaaaaaccaaatcctcctagatttactgtagaattgaaggatgcattggat
gtacaagaagccaaatccgttcattttgaatgtagagtagaaccagttaatgactctaca
ttaaggattgattggtttttcaatggaaaacctttcgctactggttcacgtgtacatgtg
ataaatgattttggatttatatctttggacatggattatgtttactcccgagattctggc
gaatatatatgccgtgcaacaaataaatggggaactgcttttacaaaagcaaaattaaca
tgcattgccaaacaaaatgtcatattagagtcacaattaccagaaggcatgagtggagaa
aaattaaaagcgttagagcaagggccagtacaagaaaaaaaaatccatgatgagatagag
gcaatgccaccaaaattcttatctcagattgaatcaacaacagtcgaagaagcaagttct
gtacattttgaaactagagtcgagcctaaaaatgatccaaaattaagagtagagtggtac
agaaatgggaaaccattaccttcagggcatagatacaaatctatatttgatttgggtttt
gtatctttggatatactgtctatgtattctgaagattcaggagagtacatttgcagagct
gtaaatgatcacggtgaagccattactaaagctatggtcacctgcaaacagctcccaaca
atattacttcaaaatcaagtaccaaaaggtatgaagaaatcagaagctttgactcaaatg
gaagcagctattaaaaaatacacatctgagattcatttgaccatagatgatttgtacgaa
gttgaaaagaaacaaccaccaagatttgtcacccaaattaaagatcagttgtcattagtt
gaaatggaatcaaccaaattcgaatgtcaattagctccagttggtgaccctaatatgaag
gttgagtggttcttaaatggcaaaccattaagacacaagaatagatttaacccaatttat
gattttggttatgttgcaatgaattttggttggatatatcctgaagatagcggtgaatat
gtttgtagggctactaatttatatggacaagatgaaacaagagccactataaaaacatct
ggtaagccaggtatcatttatgactcacagcttcctaaaggaatgaagagtattgaaaaa
ataagagaaatggaagcatcgtggcaagtaacacctgaaatgaaagaagaagaagaaaaa
cgtagagaacctccacaatttgtaagcaaaccagaacctgtcactgtatgtgaaggtgat
tgggctagattctgttgtagagtaactggtttcccaagaccaagagttatgtggctagtc
aatggaaacactgtggtgaatggaatgagatacaaattaaattacgatggaatgtggcat
cttgacataccaaagacaaggcaatatgaccatggtaaagttgaagttattgctagaaat
gcatgtggagagactcgcgtggaaacaatgctcatagtgaattcaagacatgacgattac
agaggagttttgaaaaactcacctagaccatggtacgacagtgatttggtgcagtatcaa
agagatcttaaagagaatgaactagaaaaagtgtttactgatagagcatcaaatgttcaa
aatgttgattatagtaatatgattatatcaacggttggtgatcaaatgaaacaaaaacaa
ttaaatgattcaaaaccggaatggactgaaactgtaaaacaaaaaaaaaatgaggattat
tataataaattgagtaaattggaaggagatcaagtgataaaagaagcaagaatcagagaa
gctaatcatcaagtatcaattgcaggcgagaagttgaaaactactaaaaatatgtctaaa
aattacgaagaatctttagttagagataaaaaagaagaattaatgccttggcaaacaaca
aagttacttaaagcacggggtgatcaaagtccacaaataataccggatccgtctgaatcg
tctgtacacggaaaagaaattcatgtagcaaaacagcagcaaactcaaaaagaaatacaa
ggcgataaagaaatacgaagaaaaattactgccactgagacaactgaagttgaacacaca
cgtaaaaaccaagaaagggtagttcaaggaaaagttgagccgtctaaaccgccaatattt
acaaccaaaattcaaccctgccgtgcattcgaacaggaccaagcgcgttttgaggttgaa
ttcgacggtgaaccattacccacgatcaaatggtatcgagaagactttttaatccaaaac
tcacctgacttccaaatacacacgtttagtacgaagtccatactagttattagacaagta
tttatggaagactctggtgtgtttgctgtcatcgcagagaacagaggtggcaaggcaaaa
tgcagtgctaatttacttgtcgaagaacgtaaacaagttggcaggaaaggacccggtcca
ccgagcttccttagtactatgcaaggatcagtcgtgaaagccggtcaattagtcagattt
gacgttaaaatcagcgctaataagccactggacgtatattggttaaagaatggaaagaaa
atcagccaggacattcgttacaaaacggtggatgaagataatcaatacacgctcttgatc
atcgagtcggttactgaagatagcggaacctatgagtgtgtagctattaacaattctggt
gaagcgaggtgtgaagctcagttggttgttcaacccttggaacagaaggataagcctaaa
tcaaaacctagtggaaaagaacaagcaccaacaatcactcaaccgttgtccggacaagtg
attcacgagggacaacctgtgacgttcagctgtaaaatttctggacaacctccaataacc
ataaaatggcaaaaaggcgataaagtgattaaaccatcaaaatatttccgcatgacgcaa
gatggagaaactgtatcacttcatatatccgaagtgttcccagaggacgaaggcacgtac
aaatgtctagtttcgaatgctggtggtcaggctgtcctgtcagctaatttgaaagtcatt
gtacccgaaaatcaagacatagctccaaccttgagtccgatgagagatgtcatcgttcca
gaaggtaatgcggctcagttccgcacgcaagtgtcgggacaaccgtcaccgtctgtacaa
tggttcagagaaggaatacttattcccgaaacaccagattttaagatgatgtatgaaggt
aacatggccgttctgttgataacatcgacatatgaagaagattctggtgtgttcacgtgt
cgtgccacaaatagcgctggacaagtagagacttcggccaaacttacggtgaaaagacaa
cgcggggttacttataaaaccggtacatttgacgataagggtgtagtggatagtatacaa
ctaaatcaagggttaggaaaaacaaaagaaataggtttaaaaacttctattaaaaatatt
aaaactgataaaaaggggatagaaacaaatgataatctattaccatggagaaaaggaatt
ttaatcgacagaataagaaaaacatcagtggaagcaaaaagcttaattacagagaatgta
ttcattgaacctacagaaattggtgatttaataacagtaacacaagaaggtacattcata
tatacatacgttacggaacagatatttactttaattcaaaacaaaattgatactaaagat
gtagaaaaggcaaaacaaataataaatcaagttttggtaaaaaaaatgaaacagggcgat
atcgtgagtttaaatgaaaacgataaaaatgatatagttggcgaggtaacaaataagtta
acacaattatatacaacaaaagtaaataataaatcgttagcaaaggatatattgaacaaa
gtattaacacgaacaatggaaaaagaacaaataattcaaccatatacttcagagcaacaa
aaacaagatgaaaaatttgtaacaacaacacaaatgattttaaaaaataaaaaacaaaag
gaaacttcacaaacatcggaagaattgataaaacaaaataaaacgaaaatcattaaacaa
gacataaaatcggaagataaaattcttaatcaaaaaaaccaattttatttcggagaacag
caacatgaaaattatgaaatcgtcccagatgaatacaaacccaaattaaaaactgaaaat
attgagaacattgaaacaaaaagtcaattaattaaaaatctggactacaacaccagaccg
tggttaataaatccaaatgtagaaaaaacctgttcaaaaaatgattattcaccaaaacat
gaggatacattgaaaaatgaaaaggaaacaacaaacgaaaacttaccagaaaaagtaaaa
acaaaacatattaatccttggacggaggaaaaaataaatttaagaaaacttgaaacatca
aaacttgatgaaaacagtattacaactaataataaaccaaaaagaagagaagaaagaaat
gaattgaaagaaatgaaagataaaaaaacatctatcccttggacagaagaaaatgtaaaa
ctaaaaaaaacatctactgaaaaacagagtttaactaaaaaaactgtagaagatataaca
ctaaaaccaacaaaaaactataacaataaagatcaactaaacaatgaaaatgatcaaata
cataaagatattgatgaaaaagaaacaaaaccaattaaggaagtagttaatgcaccatta
gctcaaatcagtaataaaactcaaaagaaatcaggagccccatggacggaagagaccgtc
actctaaagaagaccaaaactcaaaagcaaccgttggccaaagaatcggttgaagaggtc
actcttaaaccaataaagaagccattggttgaagatatcccattatcggaggaaactcca
atgacagaaacaactgaaatagttgaaaccgtagtggaaaaaggaagaagacgtcgtgtc
aggaaaattaaaactgacggaaaggaagaggtcgaagaaactgacgaggttgtcgaagag
aaaccgacaattgaaaatgtcgaagatatgcccgtcgaagacgtgcctactgaaccacaa
agaaagccatctgtgccatggacggaagagaccgtcactctaaagaagaccaaaactcaa
aagcaaccgttggccaaagaatcggttgaagaggtcactcttaaaccaataaagaagcca
ttggttgaagatatcccattatcggaggaaactccaatgacagaaacaactgaaatagtt
gaaaccgtagtggaaaaaggaagaagacgtcgtgtcaggaaaattaaaactgacggaaag
gaagaggtcgaagaaactgacgaggttgtcgaagagaaaccgacaattgaaaatgtcgaa
gatatgcccgtcgaagacgtgcctactgaaccacaaagaaagccatctgtgccatggacg
gaagagaccgtcactctaaagaagaccaaaactcaaaagcaaccgttggccaaagaatcg
gttgaagaggtcactcttaaaccaataaagaagccattggtagaagatatcccattatcg
gaggaaactccaatgacagaaacaactgaaatagttgaaaccgtagtggaaaaaggaaaa
agacgtcgtgtcaggaaaattaaaactgacggaaaggaaaaggtcgaagaaactgacgag
gttgtcgaagagaaaccgacaattgaaaatgtcgaagatatgcccgtcgaagacgtgcct
actgaaccacaaagaaagccatctgtgccatggacggaagagaccgtcactctaaagaag
accaaaactcaaaagcaaccgttggccaaagaatcggttgaagaggtcactcttaaacca
ataaagaagccattggttgaagatatcccattatcggaggaaactccaatgacagaaaca
actgaaatagttgaaaccgtagtggaaaaaggaagaagacgtcgtgtcaggaaaattaaa
actgacggaaaggaagaggtcgaagaaactgacgaggttgtcgaagagaaaccgacaatt
gaaaatgtcgaagatatgcccgtcgaagacgtgcctactgaaccacaaagaaagccatct
gtgccatggacggaagagaccgtcactctaaagaagaccaaaactcaaaagcaaccgttg
gccaaagaatcggttgaagaggtcactcttaaaccaataaagaaaccattggttgaagat
atcccattatcggaggaaactccaatgacagaaacaactgaaatagttgaaaccgtagtg
gaaaaaggaagaagacgtcgtgtcaggaaaattaaaactgacggaaaggaagaggtcgaa
gaaactgacgaggttgtcgaagagaaaccgacaattgaaaatgtcgaagatatgcccgtc
gaagacgtgcctactgaaccacaaagaaagccatctgtgccatggacggaagagaccgtc
actctaaagaagaccaaaactcaaaagcaaccgttggccaaagaatcggttgaagaggtc
actcttaaaccaataaagaagccattggtagaagatatcccattatcggaggaaactcca
atgacagaaacaactgaaatagttgaaaccgtagtggaaaaaggaaaaagacgtcgtgtc
aggaaaattaaaactgacggaaaggaaaaggtcgaagaaactgacgaggttgtcgaagag
aaaccgacaattgaaaatgtcgaagatatgcccgtcgaagacgtgcctactgaaccacaa
agaaagccatctgtgccatggacggaagagaccgtcactctaaagaagaccaaaactcaa
aagcaaccgttggccaaagaatcggttgaagaggtcactcttaaaccaataaagaagcca
ttggttgaagatatcccattatcggaggaaactccaatgacagaaacaactgaaatagtt
gaaaccgtagtggaaaaaggaagaagacgtcgtgtcaggaaaattaaaactgacggaaag
gaagaggtcgaagaaactgacgaggttgtcgaagagaaaccgacaattgaaaatgtcgaa
gatatgcccgtcgaagacgtgcctactgaaccacaaagaaagccatctgtgccatggacg
gaagagaccgtcactctaaagaagaccaaaactcaaaagcaaccgttggccaaagaatcg
gttgaagaggtcactcttaaaccaataaagaagccattggttgaagatatcccattatcg
gaggaaactccaatgacagaaacaactgaaatagttgaaaccgtagtggaaaaaggaaaa
agacgtcgtgtcaggaaaattaaaactgacggaaaggaaaaggtcgaagaaactgacgag
gttgtcgaagagaaaccgacgattgaagaaatcgaagatatgcccgtcgaagacgtgcct
actgaaccacaaagaaagccatctgtgccatggagggaaaagaccgtcactctaaagaag
accaaaactcaaaagcaaccgttggccaaagaatcggttgaagaggtcactcttaaacca
ataaagaagccattggttgaagatatcccattatcggaggaaactccaatgacggaaaca
actgaaaaagttgaaaccgtagaggaaaaaggaagaaggcgtcgtgtcaggaaaattaaa
actgacggaaaggaagaggtagaagaaactgtcgaggttgtcgaagagaaaccgacagtt
gaagaagtcgtacataaaccgacgattgaagaaatcgaagatatgcccgtagaagacgtg
cctactgaaccacaaagaaagccatctgtgccatggagggaagagaccgtcactctaaag
aagaccaaaactcaaaagcaaccgttggccaaagaatcggttgaagaggtcactcttaaa
ccaataaagaagccattggttaaagatatcccattatcggaggaaactccaatgacagaa
acaactgaaatagttgaaaccgtagaggaaaaaggaagaaagcgtcgtgtcaggaaaatt
aaaactgacggaaaggaagaggtagaagaaactgtcgaggttgtcgaagagaaaccgaca
gttgaagaagtggtacataaaccgacgattgaagaaatcgaagatatgcccgtagaagac
gtgcctactgaaccacaaagaaagccatctgtgccatggagggaagagaccgtcactcta
aagaagaccaaaactcaaaagcaaccgttggccaaagaatcggttgaagaggtcactctt
aaaccaataaagaagccattggttgaagatatcccattatcggaggaaactccaatgaca
gaaacaactgaaatagttgaaaccgtagaggaaaaaggaagaagacgtcgtgtcaggaaa
attaaaactgacggaaaggaagaggtagaagaaactgtcgaggttgtcgaagagaaaccg
acaattgaaaatgtcgaggatatgcccgtcgaagacgtgcctactgaaccacaaagaaag
ccatctgtgccatggagggaagagaccgtcactctgaagaagaccaaaactcaaaagcaa
ccgttggccaaagaatcggttgaagaggtcactcttaaaccaataaagaagccattggtt
gaagatatcccattatcggaggaaactccaatggcagaaacaactaaaatagttgaaacc
gtagaggaaaaaggaagaagacgtcgtgtcaggaaaattaaaactgacggaaaggaagag
gtagaagaaactgtcgaggttgtcgaagagaaaccgacagttgaagaagtggtacataaa
ccgacgattgaagaaatcgaagatatgcccgtagaagacgtgcctactgaaccacaaaga
aagccatctgtgccatggagggaagagaccgtcactctaaagaagaccaaaactcaaaag
caaccgttggccaaagaatcggttgaagaggtcactcttaaaccaataaggaagccattg
gttgaagatatcccattatcggaggaaactccaatgacagaaacaactgaaatagttgaa
accgtagtggaaaaaggaagaagacgtcgtgtcaggaaaattaaaactgacggaaaggaa
gaggtcgaagaaactgacgaggttgtcgaagagaaaccgacaattgaaaatgtcgaagat
atgcccgtcgaagacgtgcctactgaaccacaaagaaagccatctgtgccatggagggaa
gagaccgtcactctgaagaagaccaaaactcaaaagcaaccgttggccaaagaatcggtt
gaagaggtcactcttaaaccaataaagaagccattggttgaagatatcccattatcggag
gaaactccaatggcagaaacaactgaaatagttgaaaccgtagaggaaaaaggaagaaga
cgtcgtgtcaggaaaattaaaactgacggagaggaagaggtagaagaaactgtcgaggtt
gtcgaagagaaaccgacagttgaagaagtcgtacataaaccgacgattgaagaaatcgaa
gatatgcccgtagaagacatgcctactgaaccacaaagaaagccatctgtgccatggagg
gaagagaccgtcactctaaagaagaccaaaactcaaaagcaaccgttggccaaagaatcg
gttgaagaggtcacacttaaaccaataaagaagccattggttaaagatatcccattatcg
gaggaaactccaatgacagaaacaactgaaatagttgaaaccgtagaggaaaaaggaaga
agacgtcgtgtcaggaaaattaaaactgacggaaaggaagaggtagaagaaactgtcgag
gttgtcgaagagaaaccgacagttgaagaagtggtacataaaccgacgattgaagaaatc
gaagatatgcccgtagaagacgtgcctactgaaccacaaagaaagccatctgtgccatgg
agggaagagaccgtcactctaaagaagaccaaaactcaaaagcaaccgttggccaaagaa
tcggttgaagaggtcactcttaaaccaataaggaagccattggttgaagatatcccatta
tcggaggaaactccaatgacagaatcaactgaaatagttgaaaccgtagtggaaaaagga
agaagacgtcgtgtcaggaaaattaaaactgacggaaaggaagaggtcgaagaaactgac
gaggttgtcgaagagaaaccgacaattgaaaatgtcgaagatatgcccgtcgaagacgtg
cctactgaaccacaaagaaagccatctgtgccatggagggaagagaccgtcactctgaag
aagaccaaaactcaaaagcaaccgttggccaaagaatcggttgaagaggtcactcttaaa
ccaataaagaagccattggttgaagatatcccattatcggaggaaactccaatgacggaa
acaactgaaatagttgaaaccgtagaggaaaaaggaagaaggcgtcgtgtcaggaaaatt
aaaactgacggaaaggaagaggtagaagaaactgtcgaggttgtcgaagagaaaccgaca
gttgaagaagtcgtacataaaccgacgattgaagaaatcgaagatatgcccgtcgaagac
gtgcctactgaaccacaaagaaagccatctgtgccatggagggaagagaccgtcactcta
aagaagaccaaaactcaaaagcaaccgttggccaaagaatcggttgaagaggtcactctt
aaaccaataaagaagccattggttgaagatatcccattatcggaggaaactccaatgaca
gaaacaactgaaatagttgaaaccgtagaggaaaaaggaagaagacgtcgtgtcaggaaa
attaaaactgacggaaaggaagaggtagaagaaactgtcgaggttgtcgaagagaaaccg
acaattgaaaatgtcgaagatatgcccgtcgaagttgtgtctactgaaccacaaagaaag
ccatctgtgccatggagggaagagaccgtcactctgaagaagaccaaaactcaaaagcaa
ccgttggccaaagaatcggttgaagaggtcactcttaaaccaataaagaagccattggtt
gaagatatcccattatcggaggaaactccaatgactgaaacaactgaaatagttgaaacc
gtagaggaaaaaggaagaaggcgtcgtgtcaggaaaattaaaactgacggaaaggaagag
gtagaagaaactgtcgaggttgtcgaagagaaaccgacatttgaagatgtcgaagatatg
cctgtcgaagacgtgcctattgaaccacaaagaaagccatctgtgccatggagggaagag
accgtcactctgaagaagaccaaaactcaaaagcaaccgttggccaaagaatcggttgaa
gaggtcacgcttaaaccaattaagaaaccggtggtggatgatatcccactagttgagaaa
gttacagattatgataatataaatgttgataaacatattgttcaagatgttgtggatatg
aataccggaaatgtcgttgtagatgatcatcccattattaagataagattcctgaagcat
gaagatatgttgagggaagatgcaactaataagccggatgcaattgtttgtgctcaaaaa
gttatttcaattcctaaagaaaaggtgaaaaagaaaaagaaacatgtacaattaaatgaa
gatatgaaccaggaaaaggaattttcccccgatgatgaggttagtgcattgaatgatgag
gagctaccatgttctaatgtatcagacgcaaaggatcttttgggaattcttaaatctacg
gatgacgttttgacagattataatattgctctcaaggttgatgagttccctacagatatt
tctttgaagtctaaaaatataacagaacagaagatcccaaagaaattattaagtgaaaaa
ttggaacttccttggagaagaggtcgtaaggataccgatactgatgttgttggtgatgat
attaaggatgacacacattcacttactcctaaaaaagaacagttgaatgttgtagaagtg
aaaacactacagccgaaatcgttagatgttgaaaataaaccactttttgctacaataaaa
cttaaaaaagcttcaccgaagaaaacaaaagatatggaacctttagcagttcctaaagtt
caacttaaatctcatttatatagagtggaacttaatacgaatgaacattttcctacaatt
tcattgttggagcctgtttttgtagacaatggggttctttctagaaactatgctgaggct
atgaaaattaaaaaaacaaaaccaaaaaaattagtccttcctgaactagaaccagttatt
cttgaaaagtatgaaccaactgacttccattacgataaaaaggaaacaccgcaaacacat
ccgtctttaccaatacaaccacttaaaaagaaaattctagatgaagaaaccccaaaaaaa
ttagttattggaaaaggaaaaattcccactcagaatgatgatgaagagaaagtgttatta
aaaaaaataccccaaaaaccagtcgaggagaaagtggatataccgaagccaattgaaaaa
ccacaatttaaaccagaacctgatttaaaaccgtccgaagacaaagattttacattagag
ccatttaaacctataccagttggcgaaagttttgaagagggtgagccaacaccgattaaa
aatgatagttcccctgatatagaaatgccgactaaaaaacccaaatatattagaaaaaaa
ataaagaaagaagaagagcctatttctgataagaaaataatacctggaacaccaaagcct
gttccatcagttgaagataatgatataaatctcaagtataaacaagggaaaccagaacca
gaaatacctgaagaaataaaattaaaaccatttttaatagaaaaaccaacggttacgaca
gaaccagaaggtattgatttgggtaaacctgaaccatttgaatatccaagagatgatgaa
ctagtgaagcctcaatacttaaggtctaaaccagagaaaaaaatgaaaaagaaaaagcct
gtgaaaactgttgatcatcagataacaacagatgataatgacggtacatcccagccatta
cctattgtaaaagagaaacctgtactcgaagaaatggtaaccgttaatgtgaaacccgtt
aaagttgtttctgttgagttagataataaacctttattagcaactatcaaactcaagaaa
gcaccttctaaatcaaagagtgatgtcgaccatgttaaaatcccaaaagtactattaaaa
tctcatttaaaaaatattgaatacaatacacatgaacattttcctacaatttcattgttg
gagcctgtttttgtagacaatggagttctttctagaaactacgctgaggctatgaaaatt
aaaaaaacaaaaccaaaaaaattagtccttcctgaactagaaccagttattcttgaaaaa
tatgaaccaactgacttccattacgataaaaaggaaacaccgcaaacacaaccgtcttta
ccaatacaaccacttaacaagaaaattctagatgaagaaacccccaaaaaattagttatt
ggaaaaggaaaaattcccactcagaatgatgatcaagagaaagtgttattaaaaaaaata
cctcaaaaaccagtcgaggaaaaagtggatataccgaagccaattgaaaaacctcaattt
aaaccagaacttgatttaaaaccgtccgaagacaaagattttacattggagccatttaaa
cctataccagttggcgaaagttttgaagagggtgagccaacaccgattaaaaatgatagt
tcccctgatatagaaatgccgactaaaaaacccaaatatattagaaaaaaaataaagaaa
gaagaagagcctatttctgataagaaaataatacctggaacaccaaagcctgttccgtca
gttgaagataatgatataaatctcaagtataaacaagggaaaccagaaccagaaatacct
gaagaaataaaattaaaacctattcccataaaaaaacctttagataataaagaaattgat
gatgatggagtaggaaaacctaagccttttatgagtgatttacctaaaattgatataaat
tccaagtccaaaaagtcacctttaccgaaatcgataagtgttgatagccctttgcaagat
cttgaaattgttagtataaaaagaagtgaggaagttcctgagcaaaaagtgactgagaat
gaaactgtagcaccctattttattgaaaaagtgcaaccattagtagcagaacatgaaaag
cctactgcttttacatgctctgtggggggagtcccttcacctgaagtcaaatggtaccgg
gacgatcgtgaactacaaacaactgatgtttacgaaattattgtatatgagaacacatct
acattaaggatttctaaacctacagaagaacaggctggcgtttatgtttgccaagctacg
aattcagctggcatctcaacttgtactgcacttctagtggtgttagattctgaagaaatt
ggtgaagctccaatttttatggaacctattaaacctagaaaagttcggggaaaaaaatct
attcaactaaggtgtattgtaaaaggaattcctatacctgaaattatttggtgtcgtgaa
aatgaagaaataatttctgatgacgacgagtatataacttcgtttgattctaaaactggt
gaagccattttaacattagtaaatcctattgatgttgaccgatcaacatatctagctaga
gcagtaaatattcacggaaaatctgaatgcatggcacatattacatttgaaaaagaggaa
tatggagaagcgcctaagtttgtagaacggttgaagccgaaagttgtgaaagccaatgaa
acaactgtactcacatgcttagtcaaaggtgttccatcgccaacggttgtatggtgccgc
gatgatgaagaaattacaccagatgacagtcatttgttaatttacattcctgaaactgga
gaatctaaacttacaattgtacatcctgatgatattgatgaatcaacgtacacagttaat
gcaacgaataaatttggaagggctgagtgtagagcaaatttaatagttcaaaaagatgaa
attggcgaagcgccgacattcgtacaaccagtaaaaccaaaaatcgccaaattaaatgaa
ataactgaacttaaatgtacagtaagaggaacaccaaacccgttggtaatttggtgtcgt
ggaaacgaagaaattattcctgacgaaagtcatttgatcacataccatcaggaaaccggg
gaatcgatcttaacaattttaaatccatctgaaattgatgaaactatttataccataaac
gccgtcaataaatatggccaagcacaatgccgtgcaaatctaattattcaaaaagatgaa
tcgggtgaagcaccaatgttcatagaaccgataaaaccaaaaatcgccaaagctaatgcg
tctactgaattaaattgtttggttcgaggaatacctacaccaacagttgtttggtttaga
ggtgatgtagaaataattccagataacattcattcaataacgtttataccagagacgggt
gaatcaaaacttattatttcaaaggtcacagaagttgatcaaaatacgtacactgtaaaa
gcaactaacaaatatggtagagctcaatgccgggcaaatgtaattatacaagaagacgtt
ttcggtgtagctccaacttttgttgagcccataaaacccgtattagcaaaaccagatcaa
acaactgttttacgttgtttggtgactggtaacccagttccaactatagtttggtgtcgt
ggaaaggacgaaattgttcctgatgacatgcatacaattcagtttattccagaaactgga
gaatctactttgaccatagaaaaagcagcaacaattgacgaaacgcattattcagtagaa
gcaattaacaaatttggaagagctagatgcagagctaatttagttttagaaaaatatgat
actggaatcgctcctgcatttgtcgttccgattaaacctaaagccgttaagccaaccgaa
tctgtagaactaagttgcgtcgtttccggaacaccaatgccaaccgtcgtatggtgtcgc
ggggatgaacaactcatgcctgacgaaagtcatatcatatcttatacaccagagactggc
gaatccaagctaacgatttgtaacgccacggaattggacgtaaatgattatacagtaaaa
gcagtcaacgattttggtgcggcccagtgcagagccaatctgattatagacgaaatcgtt
gatgaaatacctaagtcgtgtgaagaagcaccatgcataacgaaacctttgcaacccgtc
atagcaaaaaaagactcgtgtgtgacgttagacgtgcatttcagaggaactcccgagtta
aaagttcggtggttccataatggtaaagacataactgataaaaaaacgtttgttcgcacc
ttaactataacagagaccacgaccgtaataactataaagaaaattactaagaaaaccact
ggacgttatgaagtcgtggttactaataatcgcggggaagcgaagacttctactacagta
tcaattgatgatgtagacgagacaatcgagaaagacgagactacagtcgggaaaacgccg
tactttgagacggaactgcaaacggaaacaatatgggaagatgaggaggagaaagaaaag
aaaaccacaatgtgcctcgttgtaaaggtaaagggtactcccaagcctaagatcctttgg
tatgagagtggtaaagaaataacgcccaatgaagacttccaaattgaagaacacgatgaa
ggagtatccttgttaacgatcaagaaaaggccaacagagagcgttcgggaaattacatgc
gaagctacaaacgagctcggaacggtcgctaccaggactctagtagtttcaggtatcaaa
gggacgaaagcatacaggaagccatcgtgggtgacccagatggaagagttacgggaacaa
ttgcaagcttttcaaagtttaccgagctttgtaaacgaattaaaggacgagcgagcagtt
gaaaacgaaacgattgtgtttgaatgccaattttcaggaaatcctatacccgtaataata
tggtatcacgatgacaaaattgtcagaaattcatctaatgttcaagttaagatcaccgac
accaaaacaacattgactattaaaagagcaactaaggaagatgaaggtgtttatatttgc
aaagcaaacagcaatttaggagaagctaaaaataaagcaaaactttatgttaaaaaactt
ggagaagaaacattcacggctaccgaagaagaagtggaagaaaaagaagtagaagaagtg
aagaaaacgaaaaaaacaaaaaagaaaactataaagaagaaacataaaaaggaatctgaa
tcattcgatgaaacagaaataaaagaatcaactacttctaaaacggtagaggggaaaccg
ttgttaccggaacgcgaaccgttatccacgtcagaaacaatttctgacgagacggtcagg
gaaattcgtggacccgaatttattcacgcaaaacccatcgaagaacctgctttgttcacg
gcacttaagatccggaagcccacagtggtcaatgaagttgaacaagttttagatcaagtg
gaactggctgagtttggaccggctgaatgtccattacgagaattggccactattgatgta
cttactcgacatggcatatcgatagaacaggtgatcgaagagtacacgtccggtcagttc
cctgcgctgaggaccgcgccagctcaatcagccatggtgcacttaatcgaacgtgaaggg
tacacatcactcgtggctgacgttttcactaaagaatcaaccatacctgaaaccgtcaat
gaagtgtttaaggcattcatgacaatggtcgagttgaaacacagtacactggaagagatc
attacttacttgatgccagaagatttccaaaccagcacctgggatttggaacacgcatct
caaattactacagatgatacgatcaccgaaacagctgatatcagcgaatctataaatata
ttagtaaacgaagttaagaagaaaacacgttcgacaaagagattagttaagacaagtgaa
gagagtttatcaattgaaaatgaacaagtaaagaaagttatggattatagcaatattaag
attactgataataccatagttgaattatcagaagacaaaccgatcaaaacggaaaaatgt
ataaaacaaaacaaaaatatagaagatatcagtaaaggagaagatgaggaagaagaagaa
attatcacaaaagaaacgaaaataataaaaataaataaagtaaaacgatcgaatatcgga
aaagaaattattcctgaagagacaacatatgaattcaatgtagaaaagtatcccgcaata
tgtccaaccgttttgaaaacatcaaaaactttaaatgaaacaattgctcagcaagaagct
gtagagctctcaacagatattaataacataccggaaaaagctcagattagaataacaact
cgaagcgccgcggaaagtataataacaaaagacgaagagaaagaagaaacccgaaaagaa
gcattagaaataaaaaaacatcaagcaaattcagcttttgaacttaacgaaagtttttct
acagatcatccagacgctcaatcgcctcttgaagaaattgttaaaacctttgaattcaaa
ccatgtttggcaataaatgatgttatacctaaggaaagtataacaattaatgaaatttat
ccaaatcaaagtcttggcaaaggaattgattacaaaccaaaaaataaggaagctaaggtt
actgtaatttcacattcacaaaaagtagtaacagaatcaattgcctctacaaaggaaggc
gaaattaaacaattacttatgccacagaaaaaaaaagctacacaagattatgttgaacac
gaaagtattaatgttgttgaagtaaatgaagcacataccgaaagtcaattaatagatgat
tttaaaccaacaccagtgaaatcttcagtgaaatatccactacacgaacaattagttgtt
agtgaatcacattcagaaattcaaccggaaaattactatccagaaataattgtacccact
gaagtcgcagaacaattaatagtaccatcaaataacgctataactgcattccaaatagaa
tcttctgaaaaagaagcagaatataatcattcgaaatcacccaatgagtataaagcagat
atttcgattattcctgaaaaatatattgaagtaagcgagtcaatcatacaagaaaaagaa
actaaactagaaaaagaaaaagtaccagataagtcatttgcagtttccgatataatttta
caatcaagtataattgtaaactcaattaatcaagaagaaaatgaggaaaaattcaatact
catttacctcaatcgcatactgcaaaactaacaataaacaacgcaaataaagtgagtagt
tcttcagtaatagaaattaatgaagcagaatctgatttaaacattttggtcataccagaa
acaaaacaaattgaaagttccataattggtttagaagtaactgagattatacctaaagag
acagaatccaattttacatcacaatcagcattagaaatattaccagttactagttttact
gaaaataattcgtgtatagtcactgaaactacagttgatgattattcaacagatttatta
tcaaatttgaattacaaagcatttgaagccaaaccaaagtttgaagaattagaagccaag
caaatatctcaaataaatgtacaagagaataacattccattagatgaaacttctaaacct
atttcagttaaattggaaacaagtttttatccaattcaaagcataactgtagaacaaaca
gttgcgacagaacaagaacaattcttgccattaaatgtacagcaagagttacataattct
gtaagtagtccatctcactctcttcaagttgtagttattgaagagattacaccagagaat
tgtgttacacagatagaagaaacgtataaaaacaataatcaaaatgcatcaaaaatagcc
caaattagttttgtagatgaccaatgtattattgtaaaagaagtgtcaacctatgagtca
gaaactagtttatcacttgatagtaaacctgaaaatgtaaaggctgtaccagtatttact
ggttatgatgtggctgagacattagaaataatttcaaatgatgccattgaaaaattgaac
atacaaaaatataaaaataataatgcaaaattaaaacacataccatatgaagcaattgta
tcagaagttacatctgtaaatgagttagaagacattttaccaaataaagaaaagaaacag
ctaaaaaatgtaaacattaaaattgacgaggttgttggtgtaaatattacagaacaacct
gtttacgaaaaagaaaaaacttcgattgaacaaaaagtatttataagtaaaaaggctagt
actgaatttgttccgatagagattgttgatcgctcagaaattgttacaggtgattatact
ttggatttgatacaacccgaggtatctgaatcgcatgcatatcatcaacctagtacattt
gaaagtgttattttgtacgaaactaatatatctgaaaaagaacaagagatgactgaagat
aaaactccattagtatgcactgcaaataaatctttaatagtggatgaagcaatagaagtt
acagaaataatttctgacattaaaccagaagatatttctatttccatattgcctgaagaa
aaaacagccaaaactaacattataccatttaaacctcttgagggtcaagatataacgact
tgtgaaaatgtggagacagtgaaaaatcaaagtccactgtctgaagttgcccatatatct
caaaaaccgtttcatagtttagaaacaagtttaataatattgacagattcagaaaataag
ttgtctgattttgtgatgccgaatacaaaaaaagcagagactaattatagtgacttagat
attccaattagtgttgttgaaattttaacgcaagataaagaactagattttaaaggtcaa
gaagttccatcacatacattagacaaacaagaaataatcttagaagaatgtcgggttaca
tcagaaacaatggtatgtagttctactagtgattttgatgaaattataccacaatcagtt
tatgctttgccgtctaaaagcactcaaattgcaattgagtcaatagaaaccgctcatctt
gaaaaagaaggggatttggttgacaatcatatattttcagaaagacatgcagatttcaca
tatgaagaagtaaagagtattcaaataactgaacaagttaaacttgacaccaaagaagaa
ttaataattgaaagtatacccgcggatagaaaaagtaatacaacgattacaggacaagat
gttgcggaaacatttgagactaaagtagaaagtcctattgaagaattaaaaatagaattc
ccgaaagaaaaatcagctaaaactattcaagcaaatgaagttcacagtgttgaagtatct
gaaattattacacaagaaaaagaatcttcattagatgataataaaaaatacaacacaaaa
aaagtaaacattatagttgaagataactcaggaacgtatatggttactgaaatatttccc
aaagaaaaagaaatccaatttatagaaaaatctcaacctatttatcgatatgctgaacaa
gatattttaagtcatgaaggattacaagttaacgaaacaaatatttcaatttgtgaaaaa
cagttaagtgatttagaatattcaactaaattaggcaatcgagttatagaacccctcgaa
tgcattgaaatatctgaaataaatgttcaagaaccagaatataatttacctaaattactt
catccaaaaatggaaaatgcagttaatattttaaatgaaaatgtaggtcttataataaat
tctacagttattaatgataaagaaaatgaacttaaaatcgataaattaaatacaaaaatt
gcaactaaaatatcaaatttaattggttacaaagttcctcaaaaatctgagaaaaatact
ttagagagtgttgaacttttaaaatatattaaagaagatgaacatcaagcgtcatctgaa
cacatattattggaaggcataagtacaactgtagttaattcacaagataaagaacttcca
tttgaacaattaacgaaattaacaggaaaatctgcctcgctagaatacgaaatggaacaa
aacttagatgtaactgaagtgtgtttaggagaatcagaaacagatttaattcctattttt
ttgccatcaagtcacattgctgcaagtgaattgtcggaaacccaacaagttgcatccagt
tttgaagttaccccacaaaattctactcacaatttatgtgcccaatcaatgccgtctggt
atttctataactcctaaatccacagaatcacatagtcttgaagtaactgaaactctgtat
cacgaaactgaaaaaccatttgaatcggttgaaaatgtattaaagacttgcaatcttaca
attcaagtggaccaaaatgttgagataacagaaattgtaacgaatgaatcagagaaacca
ttagatttatttgacaaaaatagaggttcagaagcgagtatagtattcgatgaaaatcag
tctgtttccatcgaagagatagaaacttctgatgatgttgttccgttaactaagaatgtg
cccaatgcattaagtgcaacaaaacagttagaactacaattaggaatcgtggttactgaa
gttagaacagaagaaaatgagattgaacatgaaacacaaattcaaccttcattaaaacat
gtttcacaaatattgccagaaaaacatagtttgaatgtgacttccgctattataattgaa
aaagaaagtatattaaataaatctaagaaagaaattcaacaaaatgcacaagtttcttcg
gtatacagccctatgaaagttgttcaatcagaagaaaattttatagaaatgagtttaacc
aatttaaagactactacaccaagtgaaatattttcagaatcttcacaaattccttatgat
tcaataaatcaattagaaattagatcattcgaaaaagaaagtgaattaaaattgactaaa
aataagaaaaaggaaatggcaacgattaatatggatactattaatatacttaccacaaca
gaaatcattacaggtgaaaaagaatctatttatacacctttaacgaaacctattacaaaa
caagctttaattgatataactgaaagccgaccagttagtaaagcttttgaagtaaaacca
gaagatattacaacggaattacaaattcctaatgtcatatcatgtaaaataacaccagct
caagaagttgtccatggtgttgttgttgttgaacatttgggtcatgataaagaagaaaaa
tttgaaggggaatacaaaccaacgctcttagcggctaacataaacgtagaaaaagaaaaa
gagacgaagactataactgaagttacaactcatgaaatggaaggccaagttaagaatata
gatatgccaacatctaaaaatgctcacatagaaataaattctgggaaagagatagcagaa
aaaatagaaatattaccaaacattgcattagggtcattgaataattttgtaactaaaaca
tcaactgctcttctagtacaagatacgtttgatagtattcaatccacaataactacaaca
gaggataaagaaaatccattcatttctgatttagtttaccaaaaatctaaagctgacatt
aatattgaagaatcaaatagtataaatataactgaagtaattgtggatgatacagaagga
aaatatgtttctccagaattaccattaacgaaaaacgctggaaaatctattttaccaaat
gaagtagcagaagcatctattgtattagctgatgaaaatttaagaacatttgataaattt
aaaacaaaagaagaatcagctaatattttactggaaacatattcaaatatatctcaaact
gaaaccactgtacaagaaagtgaaatatatcttgaacccgttaaactgatatcgaataaa
gctgacattacaatgatacctaataatagtttaacaataacagaagtaataactgatgat
tatgatgaaaaattaaatattaaaaaagaacaaaatccacaaaaaattattacatcatta
tcaaaattacacggagttccacaagtgtcagaaactatttcatcaattacaactagtaat
gtaattattcctgtaattgatagcaattatgcatcggtttcacaatcagaactatatgac
acagtgatgtcaactgaaataaatgcgttagaaaaagaaagattgtttacacaaaagcct
aaatttgaaaattttaaagcagaaattaagtttaaagaagataaatcattaaatgtcttt
gaaaccgtcttaaacgataatgaaaagccattaaaaataaatgaacctttaataaaacag
gcctcattaattcaaccaacatttgatgttcctacgatatctgaacatacgttgattgaa
actgaaattaatcttgaatcaactataataccaaaagaacaaatggttaatatatcattt
gaaaataatataaatgttcaggtgtctgaagcaaatgctatagaaacggaaagtgatttc
ttaacaccaattcaaaattctgaaactgcaactatacctgaattaataccacaaccggtt
gcaaatgttacggaagttataactagcttaaatgttcaaaattttcctcaaccgagtcag
actgaatatagcaatgctagcgcaatccattcaacatttaatagcctattacaaacaaaa
gttgaaatatcagaatcagaaaataaatttaaaaaacctaaaagtatagaagaaaaggca
tcagtaaaaactgaaacattagaaaacatcataataacagaaccggaaatatctgaaaaa
gaaggaacacttgaagcaccaaggaaaattgatttgagacatgcccaaatttcatttgaa
gaagaaaaatctagtataattatttcgaatataataagtgaagataaagaatctgaattc
actcaagcacaaacacgtaaaagttcaattgcaaaaattacattagaaaatttaaaggca
atcactaacactgagcaaaatgtatcagaaaaagaaggtacactaaacattcagaatcca
aaagatgaaactgcaaatatgacatttgaagattatcaatcaggaattatagtctcaaac
gttatacccgaatggaaagaagaaaaattaaaaattaaaaatacgacatattctactgcg
acatttattacagacaactatgaaagcttaatccaaaatcaacaaatggtaaatgaaaag
gaagaatttacaatatctgaagaaataccagaatcaacaactgcatccatcacagttgaa
aatgaaaaaataggagcagttgtatctgaaattataagtggtgaaaaagaaagcgaaata
caaacaacaaaagcaagaaaaaaatcaaaagctttaatatcaaccaaagaattaaaacca
ttagtaacaacagagacacaactattatcaaacaccgaagaaatgaaattaccaaacaaa
atttctgacacatcagcaaaaataaaattagacgaactaagccacataacaattcaagaa
ctagttcccaacgaaaaagaattgaaaatgaaacaaataaatccaattcaatacaatata
acaccaacatatttagaactactaccattagaatcaagtcaaacacaatcagaaataaca
ccaattaaatttgaaaatgaaaaaatagtcaaatgtactgcaacaaaaggtacaactcaa
ataaacaaaagtatcaatatcaacgaagatatattattagaatcagccactgacctaaga
caagaagcaataaaccgacagagagcatcaatcactgacataccattgagcacagatgac
ataatgccagcactacacggagaacaaataatatcaacggtgacacaaaacaacataaaa
cacacccaaacaaaaaaaaatcaaattgatgatattaaaacaacgacagttacggaaatt
aatcaaaaaaaaatcactaaaaagcaaacgataaaaactgtaaaggacggtgttgaaaac
gtagaggttattgaatctaaaccagagattacagagattgttgatgaggaaactaaacca
ttacccgaaatcgaatcccttcaacccgaagaagctacgctaattccagacgaggctata
tctgtcgatattaaaactacgactgttatagagggtggtaagaagaaggttactaaaaag
caaacaataaaaactgtaaaggatggtgtggaaaacgtagaggttattgaatctaaacca
gagattacagagattgttgatgaggaaactaaaccattacccgaaatcgaatcccttcaa
cccgaagaagctacgctaattccagacgaggctatatctgtcgatattaaaactacgact
gttatagagggtggtaagaagaaggttactaaaaagaaaacaataaaaactgtaaaggat
ggtgtggaaaacgtagaggttattgaatctaaaccagagattacagaggttgttgatgag
gaaagtaaaccattacctgaaatcgaatcccttcaacccgaagaagctacgctaattcca
gatgaggctacatctgtcgacataaaaactacgactgttattgagggaggtaagaagaag
gttactaaaaagaaaacaataaaaactgtaaaggacggtgttgaaaacgtagaggttatt
gaatctaaaccagagattacagagattgttgatgaggaaactaaaccattacccgaaatc
gaatcccttcaacccgaagaagctacgctaattccagacgaggctacatctgtcgatatt
aaaactacgactgttatagagggtggtaagaagaaggttactaaaaagaaaacaataaaa
actgtaaaggatggtgtggaaaacgtagaggttattgaatctaaaccagagattacagag
attgttgatgaggaaactaaaccaatacccgaaatcgaattccttaaacccgaagaagct
acgctaattccagacgaggctacatctgtcgacataaaaactacgactgttatagagggt
ggtaagaaaaaggttactaaaaagaaaacaataaaaactgtaaaggacggtattgaaaac
gtagaggttattgaatctaaaccagagataacagagattgttgatgaggaaactaaacca
ttacccgaaatcgaatcccttcaacccgaagaagctacgctaattccagacgaggctaca
tctgtcgatattaaaactacgactgttattgagggaggtaagaagaaggttactaaaaag
aaaacaataaaaactgtaaaggacggtgttgaaaacgtagaggttattgaatctaaacca
gagattacagagattgtagatgaggaaactaaaccattacccgaaatcgaatcccttcaa
cccgaagaagctacgctaattccagacgaggctacatctgtcgatattaaaactacgact
gttatagagggtggtaagaagaaggttactaaaaagaaaacaataaaaactgtaaaggat
ggtgtggaaaacgtagaggttattgaatctaaaccagagattacagagattgtagatgag
gaaactaaaccattacccgaaatcgaatcccttaaacccgaagaagctacgctaattcca
gacgaggctacatctgtcgacataaaaactacgactgttatagagggtggtaagaaaaag
gttactaaaaagaaaacaataaaaactgtaaaggacggtgtggaaaacgtagaggttatt
gaatctaaaccagagattacagagattgttgatgaggaaactaaaccattacccgaaatc
gaatcccttcaacccgaagaagcttccctaattccagatgaagctacgtctgtcgacata
aaaactacgactgttattgagggaggtaagaagaaggttactaaaaagaaaacaataaaa
actgtaaaggacggtgttgaaaacgtagaggttattgaatcaaaaccagagattacagag
attgttgatgaggaaactaaaccaatacccgatatcgaatctcttcaacccgaagaagct
acgctaattccagacgaggctacatctgtcgacataaaaactacgactgttatagagggt
ggtaagaaaaaggttactaaaaagaaaacaataaaaactgtaaaggacggtattgaaaac
gtagaggttattgaatctaaaccagagataacagagattgttgatgaggaaactaaacca
ttacccgaaatcgaatcccttcaacccgaagaagctacgctaattccagacgaggctaca
tctgtcgatattaaaactacgactgttattgagggaggtaagaagaaggttactaaaaag
aaaacaataaaaactgtaaaggacggtgttgaaaacgtagaggttattgaatctaaacca
gagattacagagattgtagatgaggaaactaaaccattaccccaaatcgaatcccttcaa
cccgaagaagctacgctaattccagacgaggctacatctgtcgatattaaaactacgact
gttatagagggtggtaagaagaaggttactaaaaagaaaacaataaaaactgtaaaggat
ggtgtggaaaacgtagaggttattgaatctaaaccagagattacagagattgttgatgag
gaaactaaaccattacccgaaatcgaatcccttaaacccgaagaagctacactaattcca
gacgaggctacatctgtcgacataaaaactacgactgttattgagggaggtaagaagaag
gttactaaaaagaaaacaataaaaactgtaaaggacggtgttgaaaacgtagaggttatt
gaatctaaaccagagattacagagattgttgatgaggaaactaaaccattacccgaaatc
gaatcccttcaacccgaagaagctacgataattccagacgaggctacatctgtcgatatt
aaaactacgactgttatagagggtggtaagaagaaggttactaaaaagaaaacaataaaa
actgtaaaggatggtgtggaaaacgtagaggttattgaatctaaaccagagattacagag
attgttgatgaggaaagtaaaccattacctgaaatcgaatcccttcaacccgaagaagct
acgctaattccagatgaggctacatctgtcgatattaaaactacgactgttattgaggga
ggtaagaagaaggttactaaaaagaaaacaataaaaactgtaaaggacggtgttgaaaac
gtagaggttattgaatctaaaccagagattacagagattgtagatgaggaaactaaacca
ttacccgaaatcgaatcccttcaacccgaagaagctacgctaattccagacgaggctaca
tctgtcgatattaaaactacgactgttatagagggtggtaagaagaaggttactaaaaag
aaaacaataaaaactgtaaaggatggtgtggaaaacgtagaggttattgaatctaaacca
gagattacagagattgttgatgaggaaactaaaccattacccgaaatcgaatcccttaaa
cccgaagaagctacactaattccagacgaggctacatctgtcgacataaaaactacgact
gttattgagggaggtaagaagaaggttactaaaaagaaaacaataaaaactgtaaaggac
ggtgttgagaacgtagaggttattgaatctaaaccagagattacagagattgttgatgag
gaaactaaaccattacccgaaatcgaatcccttcaacccgaagaagctacgataattcca
gacgaggctacatctgtcgatattaaaactacgactgttatagagggtggtaagaagaag
gttactaaaaagaaaacaataaaaactgtaaaggatggtgtggaaaacgtagaggttatt
gaatctaaaccagagattacagagattgttgatgaggaaagtaaaccattacctgaaatc
gaatcccttcaacccgaagaagctacgctaattccagatgaggctccatctgtcgacata
aaaactacgactgttattgagggaggtaagaagaaggttaataaaaagaaaacaataaaa
actgtaaaggacggtgttgaaaacgtagaggttattgaatctaaaccagagattacagag
attgttgatgaggaaactaaaccattacccgaaatcgaatcccttcaacccgaagaagct
acgctaattccagacgaggctacatctgtcgatattaaaactacgactgttatagagggt
ggtaagaagaaggttactaagaagaaaacaataaaaactgtaaaggatggtgtggaaaac
gtagaggttattgaatctaaaccagagattacagagattgttgatgaggaaactaaacca
ttacccgaaatcgaatccctcaaacccgaagaagctacactaattccagacgaggctaca
tctgtcgacataataactacgactgttatagagggtggtaagaaaaaggttactaaaaag
aaaacaataaaaactgtaaaggacggtattgaaaacgtagaggttattgaatctaaacca
gagattacagagattgtagatgaggaaactaaaccattacccgaaatggaatcccttaaa
cccgaagaagctacgctaattccagacgaggctatatctgtcgatattaaaactacgact
gttatagagggtggaaagaagaagattactaaaaagaaaacaataaaaactgtaaaggat
ggtgtggaaaacgtagaggttattgaatctaaaccagagattacagagattgtagatgag
gaaactaaaccattacccgaaatcgaatcccttaaacccgaagaagctacgctaattcca
gacgaggctacatctgtcgacataaaaactacgactgttatagagggtggtaagaaaaag
gttactaaaaagaaaacaataaaaactgtaaaggacggtgtggaaaacgtagaggttatt
gaatctaaaccagagattacagagattgttgatgaggaaactaaaccattacccgaaatc
gaatcccttcaacccgaagaagcttccctaattccagatgaagctacgtctgtcgacata
aaaactacgactgttattgagggaggtaagaagaaggttactaaaaagaaaacaataaaa
actgtaaaggacggtgttgaaaacgtagaggttattgaatcaaaaccagagattacagag
attgttgatgaggaaactaaaccaatacccgaaatcgaattccttaaacccgaagaagct
acgctaattccagacgaggctacatctgtcgacataaaaactacgactgttatagagggt
ggtaagaaaaaggttactaaaaagaaaacaataaaaactgtaaaggacggtattgaaaac
gtagaggttattgaatctaaaccagagattacagagattgttgatgaggaaactaaacca
ttacccgaaatcgaatcccttcaacccgaagaagctacgctaattccagacgaggctaca
tctgtcgatattaaaactacgactgttattgagggaggtaagaagaaggttactaaaaag
aaaacaataaaaactgtaaaggacggtgttgaaaacgtagaggttattgaatctaaacca
gagattacagagattgtagatgaggaaactaaaccattacccgaaatcgaatcccttcaa
cccgaagaagctacgctaattccagacgaggctacatctgtcgacataaaaactacgact
gttattgagggaggtaagaagaaggttactaaaaagaaaacaataaaaactgtaaaggac
ggtgttgaaaacgtagaggttattaaatcaaaaccagagattacagagattgttgataag
gaaactaaaccaatacccgatatcgaatctcttcaacccgaagaagctacgctaattcca
gacgaggctacatctgtcgacataaaaactacgactgttatagagggtggtaagaaaaag
gttactaaaaagaaaacaataaaaactgtaaaggacggtattgaaaacgtagaggttatt
gaatctaaaccagagattacagagattgttgatgaggaaactaaaccattacccgaaatc
gaatcccttaaacccgaagaagctacgctaattccagacgaggctacatctgtcgatatt
aaaactacgactgttattgagggaggtaagaagaaggttactaaaaagaaaacaataaaa
actgtaaaggacggtgttgaaaacgtagaggttattgaatctaaaccagagattacagag
attgttgatgaggaaactaaaccattacccgaaatcgaatcccttcaacccgaagaagct
acgctaattccagacgaggctacatctgtcgatattaaaactacgactgttatagagggt
ggtaagaaaaaggttactaaaaagaaaacaataaaaactgtaaaggacggtgtggaaaac
gtagaggttattgaatctaaaccagagattacagagattgttgatgaggaaactaaacca
ttacccgaaatcgaatcccttaaacccgaagaagcttccctaattcaagatgaggctacg
tctgtcgacataaaaactaccactgtcattgagggaggtaagaagaaggttactaaaaag
aaaacaataaaaactgtaaaggacggtgttgaaaacgtagaggttattgaatctaaacca
gagattacagagattgttgatgaggaaactaaaccattacccgaaatcgaatcccttcaa
cctgaagaagctacgctaattccagacgaggctacatctgtcgatattaaaactacgact
gttatagagggtggtaagaaaaaggttactaaaaagaaaacaataaaaactgtaaaggac
ggtgtggaaaacgtagaggttattgaatctaaaccagagattacagagattgtagatgag
gaaactaaaccattacccgaaatggaatcccttaaacacgaagaagctacgctaattcca
gacgaggctatatctgtcgatattaaaactacgactgttatagagggtggtaagaagaag
gttactaaaaagaaaacaataaaaactgtaaaggatggtgtggaaaacgtagaagttatt
gaatctaaaccagagattacagagattgtagatgaggaaactaaaccattacccgaaatc
gaatcccttaaacccgaagaagctacgctaattccagacgaggctacatctgtcgacata
aaaactacgactgttatagagggtggtaagaaaaaggttactaaaaagaaaacaataaaa
actgtaaaggacggtgttgaaaacgtagaggttattgaatctaaaccagagattacagag
attgttgatgaggaaactaaaccattacccgaaatcgaatcccttcaacccgaagaagct
tccctaattccagatgaagctacgtctgtcgacataaaaactacgactgttattgaggga
ggtaagaagaaggttactaaaaagaaaacaataaaaactgtaaaggacggtgttgaaaac
gtagaggttattgaatcaaaaccagagattacagagattgttgatgaggaaactaagcca
atacccgaaatcgaatcccttaaacccgaagaagctacgctaattccagacgaggctaca
tctgtcgacataaaaactacgactgttatagagggtggtaagaaaaaggttactaaaaag
aaaacaataaaaactgtaaaggacggtattgaaaacgtagaggttattgaatctaaacca
gagattacagagattgttgatgaggaaactaaaccattacccgaaatcgaatcccttcaa
cctgaagaagctacgctaattccagacgaggctacatctgtcgatattaaaattacgact
gttatagagggtggtaagaagaaggttactaaaaagaaaacaataaaaactgtaaaggac
ggtgtggaaaacgtagaggttattgaatctaaaccagagattacagagattgttgatgag
gaaactaaaccattacccgaaatcgaatcccttaaacccgaagaagctacgctaattcca
gacgaggctatatctgtcgatattaaaactacgactgttatagagggtggtaagaaaaag
gttactaaaaagaaaacaataaaaactgtaaaggacggtgtggaaaacgtagaggttatt
gaatctaaaccagagattacagagattgttgatgaggaaactaaaccattacccgaaatc
gaatcccttaaacccgaagaagctacgctaattccagacgaggctacatctgtcgatatt
aaaactacgactgttatagagggtggtaagaagaaggttactaaaaagaaaacaataaaa
actgtaaaggatggtgtggaaaacgtagaggttattgaatctaaaccagagattacagag
atttttgatgaggaaactaaaccattacccgaaatcgaatcccttaaacccgaagaagct
acgctaattccagatgaggctacatctgtcgacataaaaactacgactgttattgaggga
ggtaagaagaaggttactaaaaagaaaacaataaaaactgtaaaggacggtgttgaaaac
gtagaggttattgaatctaaaccagagattacagagattgttgatgaggaaactaaacca
ttacccgaaatcgaatcccttcaacctgaagaagctacgctaattccagacgaggctaca
tctgtcgatattaaaattacgactgttatagagggtggtaagaagaaggttactaaaaag
aaaacaataaaaactgtaaaggatggtgtggaaaacgtagaggttattgaatcaaaacca
gagattacagagattgttggtgaggaaactaaaccattacccgaaatcaaatcccttaaa
cccgaagaagctacactaattccagacgaagctacatctgtcgacataaaaactacgact
gttatagagggtggtaagaaaaaggttactaaaaagaaaacaataaaaactgtaaaggac
ggtattgaaaacgtagaggttattgaatctaaaccagagattacagagattgttgatgag
gaaactaaaccattacccgaaatcgaatcccttaaacccgaagaagctacgctaattcca
gacgaggctacatctgtcgatattaaaactacgactgttatagagggtggtaagaagaag
gttactaaaatgaaaacaataaaaactgtaaaggatggtgtggaaaacgtagaggttatt
gaatctaaaccagagattacagagatttttgatgaggaaactaaaccattacccgaaatc
gaatcccttaaacccgaagaagctacgctaattccagacgaggctacatctgtcgatatt
aaaactacgactgttattgagggaggtaagaagaaggttactaaaaagaaaacaataaaa
actgtaaaggacggtgttgaaaacgtagaggttattgaatctaaaccagagattacagag
attgttgatgaggaaactaaaccattacccgaaatcgaatcccttcaacctgaagaagct
acgctaattccagacgaggctacatctgtcgatattaaaactacgactgttatagagggt
ggtaagaagaaggttactaaaaagaaaacaataaaaactctaaaggacggtgtggaaaac
gtagaggttattgaatctaacccagagattacagagattgttgatgaggaaactaaacca
ttacccgaaatcgaatcccttcaacctgaagaagctacgctaattccagacgaggctaca
tctgtcgatattaagactacgactgttatagagggtggtaagaagaaggttactaaaaag
aaaacaataaaaactctaaaggacggtgtggaaaacgtagaggttattgaatctaaacca
gagattacagagattgttgatgaggaaactaaaccattacccgaaatcgaatcccttcaa
cccgaagaagcttccctaattccagatgaggctacgtttgtcgacataaaaactacgact
gttattgagggaggtaagaagaaggttactaaaaagaaaacaataaaaactgtaaaggac
ggtgttgaaaacgtagaggttattgaatctaaaccagagattacagagattgttgatgag
gaaactaaaccattacccgaaatcgaatcccttaaacccgaagaagctacgctaattcca
gacgaggctacatctgtcgatattaaaactacgactgttatagagggtggtaagaagaag
gttactaaaaagaaaacaataaaaactgtaaaggacggtgatgaaaacgtagaggttatt
gaatctaaaccagagtttacagagattgttgatgaggaatctaaaacattacataattta
cattctcacgatgtcgtcaaaccttcctttacctctgatattcatctttctcaaaagccc
attacacatatttatgatgacacatcactcacaaatgataatgtaccacatgatgatata
cattctacatcaccagtttatatttcagacaatcacaagtcagatgaatcaagtattgat
agtttattaaaagaagttattgacgaaaacatcgaatttcctttaaattcaactgtaaca
gatgttgacgatacttcattaattgaacaatccaaaattatcgataacattggaacacct
acttttaatgaactagaaataaaagaagcttttatggctttaaaaccaagaaaaaaaatg
tcattaactgatgaagaagaagttgttaatattacttatattccaaaacagaccaagcct
aaagaagttatagaacaagaatttagcatcaaagctcacacatatgaagaggaagaaatt
tctatgacaggcaatgtgaaactacgccgaaagtcaacagtggagtgtcctaaacaatca
ttaactataaacgagattgaaattaatcaaattaatgaagaagatcttgaaaaacctgat
gaacatacagaagaaatacccaaacctgcggatgaatttccacaaaaaacaattgaagaa
cctataataattgaagaatgtactttagataaaccttcaacagggatattatatgatgat
caaagtatatctgttataacagatgtaaaagttgaaccgatacgtaaactgtcaattaaa
caagaagtagccacagttgagtttacttctgaaaaagtcgaaactaaagtatcagaagag
gaacagcccttagaggagctggaggtcaaaataaaccctcaacgtaaatcttcccataag
aaagaaattaaagagaatttagtagaagaaagttctgttgttgttaaacgaccaaagaaa
aaagaagaaaagccacaggaaccaaccgaagaagttatttctattaaagaaataaaagaa
acacctgaagaagttcaaccggtatctgaaacagttgatataatgattgaacctaaacgt
aaaccatcaattgaaaaagaagaagctgcagatgagataactattgaaaaaatcgaaacc
attgtacaaggagaagaacaaccctcagaggaagttgaggtcaaaataaaacctaaacgt
aaaccttctcttaaaaaggatattaaagagaaatcgcccgaagaaagttctgttgtagtt
aaacgcccaaagaaaaaagaagcagtaccacaagaacaagaaccaactgaagaagtgttt
actattaaagaaataaaagaaaaaccagaagaaattcaacagttatctgaaacggttgat
gtaaagatagaacctaaacgtaaaccatcaattaaaaaagaagaaactgcagatgagata
actatagaaaaagtcgaaactattgtacaagaagaagaacaaccctcagaggaagttgag
gtcaaaataaaacctaaacgtaaaccttctcttaaaaaggatattaaagagaaatcgccc
gaagaaagttctgttgtagttaaacgcccaaagaaaaaagaagcagtaccacaagaacaa
gaaccaactgaagaagtgtttactattaaagaaataaaagaaaaaccagaagaaattcaa
cagttatctgaaactgttgatgtaaagatagaacctaaacgtaaaccatcaattaaaaaa
gaagaagctgcagatgagataactattgaaaaattcgaaaccattgtacaagaagaagaa
caaccctcagaggaagttgaggtcaaaataaaacctaaacgtaaaccttctcttaaaaaa
gacattaaagagaaatcgcccgaagaaagttctgttgtagttaaacgcccaaagaaaaaa
gaagcagtaccacaagaacaagaaccaactgaagaagtgtttactattaaagaaataaaa
gaaaaaccagaagaaattcaacagttatctgaaacggttgatgtaaagatagaagctgaa
cgtaaactatcaattaaaaaagaagaagctgcagatgagataactatagaaaaagtcgaa
actattgtacaagaagaagaacaaccctcagaggaagttgaggtcaaaataaaacctaaa
cgtaaaccttctcttaaaaaggatattaaagagaaatcgcccgaagaaagttctgttgta
gttaaacgcccaaagaaaaaagaagcagtaccacaagaacaaaaaccaactgaagaagtg
tttactattaaagaaataaaagaaaaaccagaagaaattcaacagttatctgaaacggtt
gatgtaaagatagaacctgaacgtaaactatcaattaaaaaagaagaagctgcagatgag
ataactatagaaaaagtcgaaactattgtacaagaagaagaacaaccctcagaggaagtt
gaggtcaaaataaaacctaaacgtaaaccttctcttaaaaaagacattaaagagaaatcg
cccgaagaaagttctgttgtagttaaacgcccaaagaaaaaagaagcagtaccacaagaa
caagaaccaactgaagaagtgtttactattaaagaaataaaagaaaaaccagaagaaatt
caacagttatctgaaacggttgatgtaaagatagaacctaaacgtaaaccatcaattaaa
aaagaagaagctgcagatgagataactatagaaaaagtcgaaactattgtacaagaagaa
gaacaaccctcagaggaagttgaggtcaaaataaaacctaaacgtaaaccttctcttaaa
aaggatgttaaagagaaatcgcccgaagaaagttctgttgtagttaaacgcccaaagaaa
aaagaagcagtaccacaagaacaaaaaccaactgaagaagtgtttactattaaagaaata
aaagaaaaaccagaagaaattcaacagttatctgaaacggttgatgtaaagatagaacct
aaacgtaaaccatcaattaaaaaagaagaagctgcagatgagataactatagaaaaagtc
gaaacttttgtacaagaagaagaacaaccctcagaggaagttgaggtcaaaataaaacct
aaacgtaaaccttctcttaaaaaggacattaaagagaaatcgcccgaagaaagttctgtt
gtagttaaacgcccaaagaaaaaagaagcagtaccacaagaacaagaaccaactgaagaa
gtgtttactattaaagaaataaaagaaaaaccagaacaaattcaacagttatctgaaacg
gttgatgtaaagatagaacctaaacgtaaaccatcaattaaaaaagaagaagctgcagat
gagataactatagaaaaagtcgaaactattgtacaagaagaagaacaaccctcagaggaa
gttgaggtcaaaataaaacctaaacgtaaaccttctcttaaaaaggacattaaagagaaa
tcgcccgaagaaagttctgttgtagttaaacgcccaaagaaaaaagaagcagtaccgcaa
gaacaagaatcaactgaggaagtttttactattaaagaaataaaagataaaccagaagaa
attcaacagatatctgaaacggttgatgtaaagatagaacctaaacgtaaaccatcaatt
aaaaaagaggaagctgcagatgagataactattgaaaaattcgaaaccattgtacaagga
gaagaacaaccctctgaggaagttgaggacaaaataaaacctaaacgtaaaccttctatt
aaaaaggacattaaagagaaatcgcccgaagaaagttctgttgtagttaaacgcccaaag
aaaaaagaagcagtaccgcaagaacaagaatcaactgaggaagtttttactattaaagaa
ataaaagataaaccagaagaaattcaacagatatctgaaacggttgatgtaaagatagaa
cctaaacgtaaaccatcaattaaaaaagaggaagctgcagatgagataactattgaaaaa
ttcgaaaccattgtacaaggagaagaacaaccctctgaggaagttgaggacaaaataaaa
cctaaacgtaaaccttctcttaaaaaggacattaaagagaaatcgcccgaagaaagttct
gttgtagttaaacgcccaaagaaaaaagaagcagtacctcaagaacaagaatcaactgaa
gaagtttttactattaaagaaataaaagataaaccagaagaaattcaacagatatctgaa
actgttgatgtaaagatagaacctaaacgtaaaccatcaattaaaaaagaggaagctgca
gatgagataactattgaaaaattcgaaaccattgtacaagaagaagaacaaccctctgag
gaagttgaggacaaaataaaacctaaacgtaaaccttctcttaaaaaggacattaaagag
aaatcgcccgaagaaagttctgttgtagttaaacgcccaaagaaaaaagaagcagtacct
caagaacaagaatcaactgaagaagtttttactattaaagaaataaaagataaaccagaa
gaaattcaacagatatctgaaactgttgatgtaaagatagaacctaaacgtaaaccatca
attaaaaaagaggaagctgcagatgagataactattgaaaaattcgaaaccattgtacaa
gaagaagaacaaccctcagaggaagttgaggtcaaaataaaacctaaacgtaaaccttct
attaaaaaggacattaaagagaaatcgcccgaagaaagttctgttgtagttaaacgccca
aagaaaaaagaagcagtaccgcaagaacaagaatcaactgaagaagtttttactattaaa
gaaataaaagataaaccagaagaaattcaacagatatctgaaactgttgatgtaaagata
gaacctaaacgtaaaccttcatttaaaaaagaagaagcggcagatgagataactattgta
aaagaagaagaacaacccatagaggaagttgaggtcaaattaaaatctaaacgtaaacct
tcttttgaagaggaatccaaagagaaatctttcgatgaagcttctgttatagttaaacgt
ccgaagaaaagattagaaaaaccgatagaagtagatgagactgatgaagtgtttacagtt
aagaaaacactagagaagccttgtatgttgaacgatgaattctctgaaactgtagaattt
aaaataaaacctaaacaaagttcctcgtcttataatgttgatgaaggaactgaggagtta
tttaaaatagatttaaaacccaaaaaagaattacaagatataattatttacgaagaagag
tcgttagattttaaggttaaacgaaaaccatcaatacagtccttcagccaagatggagct
gagctgaaaatagttcaagaaaaagacgtttttttgaaggataataacattttacaagaa
gatagtcatgatggtgaaataatgtttgcaatccgctcatatattgctgaaaatgaagat
gctttagacttagttgaaggagaaaaagtctatgttatagaaagtaataaccaagattgg
tggtttgttaaaaaacatttaacggaagaaaaaggctgggttccttctatttacttaaga
gatgaaaccagttacatgcggtacgtgcaaaagaaattacatgaaaagattgataaactg
ccaattttccaaagacatgcttcaaatgaaaaaccttcagctccacgttttgtagaaaaa
cttcaacccaagcatgtaccagatggtggtacagttcagtttgagtgtcacgtagaagga
aatcctagaccacaaattacatggtttaggcaaacggcaataattaaaccatctcaagat
ttccaaatattctatgatgaagataatgttgcaacgttaataataagagaaatttttcct
gaagatgcaggtacattcacttgtgttgctaaaaatatagccggatttgcatctagtaca
acagaattaaccgttgaagcaccattatcagaccatggctctgatgtaacaggtctttcc
agaaagagcatgtctagagaatcatcattagctgatatactagaaggtataccccctaca
ttttctcgtaaaccaaaagccacatgtacatcagagcattcagatgttatacttgaatgt
cgtcttgtagctgtgccagagccagacatattttggcattataatggtagagaaatttcg
attaccgattctataaaagtgaatacatactcagatatgcacttctacgtgagcagcatt
aaaattaatgacgtcctaaagactcaagaaggtatatacactgtaatagcaagaaataga
gaaggtgaggctaaaatggatttagtgctcaaagtaaaaactggtttaccagagaaacca
caaatacttgaacctctttacgatataactataaatgagggtgagactgcagtgttaagt
actcaaattagtggagagccacagcctatggtcgaatggctaaaaaacagtaaaaaaata
actgatatcaaaactgttgtgaccaaagatggaattcattcattaaccattaataatcca
actcctcgtgattccgcaaaatacactgtaatagcttcaaacaaacttggtagtgcacaa
actacgtgtttcctggcagttgaagaactccctggaccacaagcgccattgtttattgaa
cgtttccaagaacaaaccgtcaaagaaaaaggaactattacattgattgctaaggtaacc
ggaaatccagtcccaatagtttcttggtttagaaataataaaccattacttgcttcgtcc
aagaaaaaagaagtatttgatggtgaaaatatagttttggaaatcataaatgctgatagt
gaagaagatgccggcgattacaaatgtgtagcaacaaacacattcggcaccgccacacat
ggtgctagagtgtcggttgatgtaccacaagtgaaattcacgcaaccactgtcagatata
gaagttgatgaaaaacaagcaatttatttggaatgtgaaacatcacacacagtttccaca
aaatggcaattgaatggcaaagaccttactggtatggaccatcgagaattgcaccaagaa
ggacgattccatcggttaattatcaaaaagtcgagcattcttgattccggaaaatacact
tgtttggttaaagaccagattacttcctgcacagtagtagttcacgacgtgaaagcagaa
ttcgttaagaaacttgaagatgtagaagtaaaagaaaacgattgtgcaatattggaggta
gaagtttcttcggaaactgtgaatgttacttggcacaagaacggcgaaatgcttacggat
ggtatgaaaaataaaatattctttgaaaaggaaggtcaaacacgtaagctaattattcga
agcatatctgttcacgatgacggcgaatatacgtgttcgttaggtgaacaagaatgtaca
gcagaaataaatgttatagaacttgcaccacaaataataaaaaaactaaaagatcaaaaa
gtggctactggtgaacaagtgttatttgaaatagaattaactaaaggtgatgctttagtt
aaatggacaaaagatggcaaagaattacacttaaataataatgtaagattaaccatcgat
ggcaaacgacagaaattagagatagtcaatgctacaaaaactgatactggagtttatgga
tgtcaagttcatgaacaaacttgtacagcaaaattaactgtcgaagaaccaaaagccagt
tttgtaaaaaaattacctgatatcacactcgccgttcaaggtagtgatattaaactaaca
gtcgagctttccaaaccggatgtaccagtaaaatggctaagatcaggtaaagtgattaag
gaatcagacaaatatgaaattatttctgaaggagccgtccacactctagttattaaaaaa
cctactactgatgatgaagcagaatatatttgtacggctgtgaacgtaaaaacatcaacg
aaattaaaagttgaagttaaagaagaaccacccaaaataaataaccttccaaaagaatat
cgtttgaaaaatggggaagatctaaacatgaatgtaacatttacatcaacaatgatgccg
acagtagaatggtttatcaacggaagcgtcctaataaaatcaaatagagtgtcctattct
attagtgaatcatcagtgagtttaacgataacgaagatcgaagaagtagacaccggtgtc
ttaactttaaaattaaaaaatatttacggggaaactacagcagacatggacattgttgtt
atcaaattacctggtgaaccgggagttccagacgttatagaagtcacagacacttctgtc
acacttcattggaaacctccacaatttgatggaaattcgccaattgagggttacattgtt
gaatatcatgacaaagatgaatttatggtatggcataaggtacaagtaacagataccaca
catgaagtcataaatttagtaactggacatgaagtaatgttcaaagtggcagcgataaac
tgtgctggaataggaccggcatcgcacaatacaaaatatgttaagatggcaagtcccggg
tcatttactccccctgtcattcaggaacccttatctgacttatcaattggaatgggtaaa
tcggcagttcttcagtgtgttattactggaaaacccactccggatattaaatggcttaag
aacaaaaccgtatacaaaacaaagacaacgtcctttgaaaaccatgtggctaagttgatg
atcgccgagtgcaatgaatctacaccaggaacttacacgtgccaagcgaccaacggagcg
ggtactgcgcaaacatcgtgcaaactcagcgtacaagatgtacctaaaattgaagtccat
gaatcggagacttcacaaatgattagagtgcgaaatcaatggaaggtcaaagctacgtac
aaaggttatccaaagccaaccatttcgtggcaaaagaacagtgtaccattacccgtgtct
gataaacacataagtgtatacgacgacgaagacgaatggtcatcgacaatagctatttac
tcagtggaaagaccggacactggcgtgtatacaattaccgcgtcgaacgcagccggcacg
gctacgtgcaatctgaacctcaaagttattgagccggctaaggacgataaaccaagcgca
ccgcaaggtccaatgcgcattaaagaaataaactcggactctgtgacaatcgagtggaac
aaaccatccgatgacggtggtttggacatatcatcataccagattgaaaggtgcaacgtt
ggcaagatgatctggtctaaggtagccgacgtagaccatgacgtatcagcatacagcgtg
caaaagttacacgaagacgccgagtacatgtttagagtttgcgctcaaaacgctgttggc
gcatcagactttttggatagcgaacctgttaccgttaagtgtcgataccataaaccgtcg
gcaccacagggcccattacagatcacgggtgtgacggatacatctttgacaatcgcttgg
ttaccacctttcgataatggtggaatagcaatcgaagactattgcgtagaaatcaaggaa
gtagacaaaaaagcttggagaaagataagttccacaaaagatttacacttaaaggtgtcg
gacttgaagaaaggatcgtcctacgacatcaggattatcgctaggaatcacgtgggatac
gggaaaccgtatcaaccagacgaacctattgtggccggcaagcgcataagctttagaaat
ggaatatccgatgaaacattatacgtacttatgggaatattcccaaccaaatcaagagct
tctgcttcgccgtccccgcccacggaattcactgtgagtgacattaccagcaaaaccgtt
acgttacattggggactaccagaaagtaatggtggatctgaaatcacaggctatgtgatt
gaaaaacagctgaacacgacgaacaaatggttcaaagtagctacgctagaaccgactaca
atgaaatattgcgtagaaaacttgaaagaaaaatcggaatattatttcaagatttatgcg
gaaaattgcatcggcctaagtcaaccggttgaaacgaaattagtcagtctgttaacccat
gctaccgtaccctcgcctcccactgctccgcttgaagttcgaaatctgagttccaacgca
gtaatagtagaatggggtgtaccggaaacggacggcggtgcaccgctgctgggttataac
atagcgattcgggacgagaagaaaactatgtggatggaagttggacgtgtggacacggac
gtacaaaaattcaatatcaaagatttacaggagaaccataggtatcacattaggatattg
gctaaaaacgaagtgggtgtcagtgagccactagaaactgaagaaccgtacaccgtgcaa
aaaccgacagattattacgagtcggacgttgaagaatcggtcatggaatccaaaccgtct
ctgacgcaaacgtcggaaaccactacgtcatggctcagagaaaacaatatggacgctgac
atatcgtcatattcgaatgctgcgttattgaagaggagtgaatactttttccgcatttgg
tattacgcgagaacattattcaaataa

DBGET integrated database retrieval system