KEGG   Rhopalosiphum maidis (corn leaf aphid): 113555861Help
Entry
113555861         CDS       T06065                                 

Definition
(RefSeq) probable phospholipid hydroperoxide glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
rmd  Rhopalosiphum maidis (corn leaf aphid)
Pathway
rmd00480  Glutathione metabolism
rmd00590  Arachidonic acid metabolism
rmd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rmd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    113555861
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    113555861
Enzymes [BR:rmd01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     113555861
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin Cylicin_N Cytochrom_C552
Motif
Other DBs
NCBI-GeneID: 113555861
NCBI-ProteinID: XP_026816240
Position
4
AA seq 280 aa AA seqDB search
MYPVILSACPAWQLHKSISIKEQLHLKYCQYCYNRHTNNLKVNVYKQKKMEAQEYILFIF
AVLSFWTAPISADIYQSYDPFDWQSSRSADFSESLPNESIDTDRSCLEYSDEDTNGNFYN
YTVQKPNGQNICLKKYAGQVLIIVNYASACGFTYDNVCTLSELSKKYKNQGLTILIFPSN
DFLQNIGGNTAAELLAKKHPEFEVFSEICVNGKAQHPVYRFLTNKLPGTFNSKCIKWNFT
KFVIDREGCPVQRFSATDSFKDIEKLIKELLEKPSFKCDD
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgtatcctgtcattttgtcagcttgcccagcttggcagttgcataaatctataagtatc
aaagagcagctgcatttaaaatattgtcaatactgttataaccgccatacaaataatttg
aaagttaatgtttataagcaaaaaaaaatggaggctcaagaatatattcttttcattttt
gccgttttatcgttttggacagcaccaatttctgctgacatttaccaatcatacgaccct
tttgactggcagtcttcgcggtcggccgacttttcagaatcgctaccaaacgagtcaatc
gacaccgacagatcgtgtttggaatacagcgatgaggacacaaacggcaatttttataat
tacaccgtacaaaagcctaatggacagaatatttgcttgaagaaatacgctggacaagta
ttgatcattgtaaattacgcatctgcgtgtggtttcacctacgacaatgtgtgcactctt
tccgaactgtctaaaaagtacaaaaatcaaggcttaacgatactgatatttcccagcaac
gatttcttacagaatatcggtgggaataccgcagcggaactattggcaaaaaaacatcct
gaattcgaagtgttttcggaaatatgcgtaaatggtaaagcacaacatccggtctacaga
tttctcacgaataagttaccaggcaccttcaactccaaatgtataaaatggaattttaca
aaatttgtaatagacagagaaggatgtcctgttcaaagattttcggcaacagacagtttt
aaagacatagaaaaattaataaaagaacttttagagaagccatctttcaaatgtgacgat
taa

DBGET integrated database retrieval system