KEGG   Rhopalosiphum maidis (corn leaf aphid): 113556380Help
Entry
113556380         CDS       T06065                                 

Definition
(RefSeq) rho-associated protein kinase 2
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
rmd  Rhopalosiphum maidis (corn leaf aphid)
Pathway
rmd04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:rmd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    113556380
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rmd01001]
    113556380
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rmd03036]
    113556380
Enzymes [BR:rmd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     113556380
Protein kinases [BR:rmd01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   113556380
Chromosome and associated proteins [BR:rmd03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    113556380
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Rho_Binding Kinase-like PH C1_1 Pkinase_C APH C1_2
Motif
Other DBs
NCBI-GeneID: 113556380
NCBI-ProteinID: XP_026817079
Position
3
AA seq 1374 aa AA seqDB search
MKEMEVIKEEDRLRRLQILEKKIRDPRNVSNVDSLLDTVQALVADCENPAVKRMKNVEAF
MQRYDKFASDICQLRMKPDDFNLIKVIGRGAFGEVQLVRHKSNNKVYAMKLLSKFEMIKR
SDSAFFWEERDIMAHANSEWIVQLHFAFQDHKYLYMVMDYMPGGDLVNLMSNYDVPEKWA
KFYCAEVVLALDAIHSMGFVHRDVKPDNMLLDKYGHLKLADFGTCMRMGSDGMVRSDTAV
GTPDYISPEVLESQGGTGTGDHGVYGRECDWWSVGVFVYEMLIGDTPFYADSLVGTYSKI
MDHKNSLSFPSDIEISQNAKSLIYAFLTNRKKRLGRNGISEIKEHPFFQNDQWSFDNLRD
CVPPVVPELNGDDDTSNFDDVEKDDGPEENFPVPKAFAGNHLPFVGFTYSRDYQLLGNNV
TNGECLPDTVDCKETSHIVVLKRELDNERKELLVVRDQNNKLLMQLQDGADRELLLKQKS
SALNTSISNLHKDLKDAQRKADNECEMRRKTESLLQELKRKLDEEQNKRTKEMNNNQQHN
DKINSLEKQMTELHEKLKVETDTCTKLRKQAAELGVAKAANERMAVELQTMLTTLQLNRD
TLHEELATLQGQLSQEKSSLRDLQLELEGRLQACQADLVRSKLREQKLSEDNRQLGERTS
VLEKECASLVLELKTAQNRYQQEVRAHEETEKSRLVNNEQANLEIVKVKMDYIFKALQTK
LSEEKSARQKADSLTQEKERQISMLSVDYRQIQQRLQKLEGEHRQEVEKSKALHVQIDQE
LTKKSALQSELGVHISEATQLRAREAQLLREVTLLRENKRAIEEELHKLKTEHSVTDLQM
KELQDQLEAEQYFSTLYKTQAAELREEVEDRGKGAAELEEERGSLAHQLQIALARADSEA
LARSIAEETIIDLDKEKTMRELELRDSQNRHRNDLESKEFTLNNLREVENELKKKMEQLI
KDNEELKTQLTIIQEESKKNFIEELEKLRKQLKQEQLLKAQAVNKLAEIMNRKDNTTKGK
SKVSSADLRRKEKECRKLQQELTQEREKYNQEVTKWQKELQELQSQVVDENASKLRLQME
LDSKDSEIEQLQGKLTNLGSETASLSSADNDDTDIYTQESRLEGWLSVPNKQNIRRHGWK
KQYVVVSSKKIFFYNSESDKQNTDPILIINLNKVFHVRSVTQGDVIRADAKDIPRIFQLL
YAGEGEARRPNESGPEHLSRSTSVTSTVDEKPGTITLKGHEFVQISFHMPTNCEVCPKPL
SNVFRPPPALECRSCRIKVHKEHLERKEDAIAPCKLHNDPTSAKELLILAPSRDDQKLWV
QRLSKKIQKCGYKANTNLDGSKISPRESTRSTLKLYSGSSVHQRSATLPSNISK
NT seq 4125 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagatggaggttatcaaagaagaagataggttgcggcgattgcaaatcctcgag
aaaaagatacgagatccaagaaatgtttcaaatgttgattctttgttggacactgtacaa
gcattagtggctgattgtgaaaaccctgcagttaaacgaatgaaaaatgtcgaagcattt
atgcaaagatatgataaatttgcctctgatatttgtcaattacgtatgaaacctgatgat
ttcaatcttattaaagttattggaagaggagcttttggtgaagttcaattggtgcgtcat
aaatcaaataataaagtgtatgccatgaaattgttaagtaaatttgaaatgataaagcgg
tcagattcagcatttttttgggaagaacgtgatattatggcacatgcaaattcagagtgg
attgttcaacttcattttgcttttcaagatcataaatatttatatatggttatggattat
atgccaggtggtgatcttgttaatttaatgtccaattatgatgttcctgaaaaatgggca
aagttttattgtgctgaagttgtgttagcattagatgcaattcactcaatgggatttgta
cacagggatgttaaacctgataatatgctattggataaatatggtcatttaaaattagct
gattttggaacgtgtatgagaatgggatcggatgggatggttagatctgacacagctgtt
ggaacacctgattacatttcaccagaagtattagaatctcaaggcggaactggaacagga
gaccatggcgtttatggtagagagtgcgattggtggtctgttggtgtttttgtctatgaa
atgctcattggagataccccattctatgcagattcacttgttggaacatacagtaaaata
atggaccataaaaattctctaagttttccttctgatattgaaatatcccaaaatgctaaa
tctttgatctatgcatttctcactaataggaaaaaacgtctcggaagaaatggaattagt
gaaattaaggaacatcctttttttcaaaatgatcagtggagttttgataatttaagagat
tgtgtacctcctgttgtcccagagttaaatggtgacgatgacacaagtaattttgacgat
gttgaaaaagatgatggtccagaagaaaatttccctgttcctaaagcatttgctggaaat
catttaccatttgtaggattcacttattctagagattatcaattattggggaacaatgta
acaaatggagaatgtttacctgatactgtggattgtaaagaaacttctcatattgttgtt
cttaaaagagaattggataacgaaagaaaagaattgttagttgtacgtgatcagaataat
aagctattgatgcagttacaagatggagctgaccgagaattacttctcaaacaaaaatca
tcagccttaaatacttctatttctaatctccacaaagacttgaaagatgcacaaagaaaa
gctgacaatgaatgtgaaatgcgtaggaaaactgaatcattattacaagaattaaaaaga
aaactagatgaggaacaaaataaaagaacaaaagagatgaacaataaccaacaacataat
gataaaataaattccctcgaaaaacaaatgaccgagctgcacgaaaaacttaaagtggaa
acagatacttgtactaagcttcgtaaacaagcggctgaattgggagttgccaaagcagct
aatgaacgtatggctgttgaactgcaaacaatgttaactactttgcaactaaatcgagac
acattacatgaagaattagcaacattacaaggtcaattgtctcaagaaaaaagttcactg
cgagatttacaactggaacttgaaggtcgtttgcaagcctgtcaagctgatcttgtgcgc
tctaaattaagagaacaaaaattaagtgaagacaatagacaacttggagaaagaacatca
gtattggaaaaagaatgtgcatctttagtgttggaattaaaaactgctcaaaatagatat
caacaagaagtgagggctcacgaagaaacagaaaaaagcagattagtgaataatgagcag
gctaatcttgaaatagtaaaagttaaaatggattatatatttaaagcgcttcaaactaaa
ctaagtgaagaaaaaagtgccagacaaaaagctgactcccttactcaagagaaagaacga
cagatatcaatgctttctgttgattatcgtcaaatacaacagaggcttcaaaaacttgaa
ggtgaacatcgacaagaagtagaaaaaagcaaagcattacatgttcaaattgatcaagaa
ttaacaaaaaaatctgctttgcaatctgaattgggtgtgcatatatctgaagcgacacaa
ttacgtgccagagaagcacaattattgcgagaagttactttattaagagaaaataaacgt
gctattgaagaagaactgcataaattaaagactgaacactcggtgactgatttacagatg
aaagaactacaagaccaattagaagcagaacaatacttttcaactttgtacaagactcaa
gctgccgaactccgtgaagaagtcgaggatagaggaaagggcgctgccgagttggaagaa
gaacgtggctcactagctcatcaattacaaatagcattagctagagctgatagtgaagca
cttgctagatctatagctgaagaaactattatagatcttgataaggaaaagacaatgaga
gagctagaactaagagacagtcaaaatcggcatcgcaatgacttagaatcaaaagaattt
actcttaataatttgagagaagtagaaaatgaattaaagaaaaaaatggagcaattgatt
aaagataatgaagagttgaaaacccagttaactataattcaagaagaaagtaaaaagaat
tttattgaggaacttgaaaagcttagaaaacaacttaagcaagaacagctgctgaaagct
caggctgttaataaactagctgaaatcatgaatcgtaaagataacacaaccaaaggaaag
agtaaagtatcatccgccgatttgcgtagaaaggagaaagaatgtcgaaaattacaacaa
gaattgacacaagaacgagagaaatacaatcaagaagttacaaagtggcagaaagaactt
caagaacttcaatcacaagtagtagacgagaacgctagtaaactaagacttcaaatggaa
cttgattcaaaagattcagaaattgaacaacttcaaggaaaattaaccaatttaggtagt
gagacagcatctctaagtagtgctgacaatgatgacactgatatctacactcaagaatcc
agattagaaggctggttatcagttccaaacaaacaaaacataagacgacatggttggaaa
aaacaatatgttgtagtatcatcaaagaaaatatttttctacaattctgaaagtgacaaa
caaaatactgatcccatattaattataaatttaaataaagtgtttcatgtacgatcagta
actcaaggtgatgttattcgagcagatgctaaagacatccccagaatatttcaactttta
tatgcaggtgaaggtgaggctagaagacctaatgaatctgggccagaacatctatcaaga
agtacaagtgttacaagcactgtggatgagaagcctggtacaattacattaaaaggacat
gaatttgttcaaatatcgttccacatgccaacaaattgtgaagtatgtcctaaaccattg
tcaaatgtttttagacctccgccagcactagagtgtagaagctgtagaattaaagttcac
aaagaacatcttgagcgcaaagaagatgcgattgcaccatgcaagctgcataatgatcca
acatcagctaaggagctgttgatcctggcgcctagtcgtgatgatcaaaagttgtgggtg
cagaggttaagtaaaaaaatccaaaagtgtggatacaaagctaatactaatttagatggt
tccaaaatatcgccaagagaatcaactcgatccacattaaaactctattctggaagttct
gtacatcagagatctgcaacgttaccatccaacatttctaaataa

DBGET integrated database retrieval system