KEGG   Rhopalosiphum maidis (corn leaf aphid): 113556612Help
Entry
113556612         CDS       T06065                                 

Definition
(RefSeq) succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
rmd  Rhopalosiphum maidis (corn leaf aphid)
Pathway
rmd00020  Citrate cycle (TCA cycle)
rmd00640  Propanoate metabolism
rmd01100  Metabolic pathways
rmd01200  Carbon metabolism
Module
rmd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rmd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rmd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    113556612
   00640 Propanoate metabolism
    113556612
Enzymes [BR:rmd01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     113556612
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     113556612
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 113556612
NCBI-ProteinID: XP_026817468
Position
1
AA seq 329 aa AA seqDB search
MAASTRIFSRIAVCNLMGIRSSSNTVDPRIYAETRKNLLLTKDTKVICQGMTGKQGTFHS
TQAIEYGTRMVGGVSPGKGGKTHLGLPIFNSVKEAREETGADATVIYVPPPGAAKAISEA
IDAEVPLIVCITEGIPQQDMVRVKHKLIRQNKSRLLGPNCPGIIAPEQCKIGIMPGHIHL
KGSVGVVSRSGTLTYEAVHQTSQVGLGQTLCVGIGGDPFNGTDFIDCLEVFLQDPNTHGI
ILIGEIGGLQEEMAAEYLIEHNSGPNAKPVVSFIAGLTAPPGRRMGHAGAIISGGKGGAQ
DKINALEKAGVVVTRSPAAMGIELSKLMK
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggctgcttccactaggattttttcacgaatcgcagtatgcaatttgatgggcatacga
tcatcatcaaatacagttgacccacgtatttatgctgaaacaagaaaaaatttactactc
acaaaagatactaaagtaatttgtcaaggaatgactggtaaacaaggaacgttccattct
actcaggctatagagtacggaactcgtatggtaggtggtgtatcccctggcaaaggtgga
aaaactcatttaggcttaccaattttcaactctgtcaaagaagcaagagaagaaactgga
gcagatgctacagttatttatgtaccaccaccaggcgccgcaaaagcaatctcagaagct
atagatgctgaggttcctttaattgtttgtattacagaaggaattccccaacaagatatg
gtacgagtgaaacataaattaattagacaaaataaatctagattgcttggacctaattgt
cctggaatcattgctccagaacaatgtaaaattggtattatgcctggtcatatccattta
aaaggatctgttggtgtagtatctcggtcaggtacacttacttatgaagctgttcatcaa
acatctcaagttggtcttggacaaacattgtgtgttggtattggtggtgatccattcaat
ggtactgattttatagattgcttagaagtatttttacaagacccaaatacacatggtatt
attctcattggtgaaattggtggtctacaagaagaaatggctgctgaatatttgatagaa
cataattctggtccaaatgctaaaccagtcgtatcattcattgctggtctaacagctcca
ccaggccgcagaatgggacatgctggagcaattatatctggtggaaaaggtggagctcaa
gacaaaattaatgcattagaaaaggctggtgtggtcgttactaggagtccagctgccatg
ggcattgaattatctaaattgatgaaataa

DBGET integrated database retrieval system