KEGG   Rhopalosiphum maidis (corn leaf aphid): 113558107Help
Entry
113558107         CDS       T06065                                 

Definition
(RefSeq) interleukin-1 receptor-associated kinase 4-like
Organism
rmd  Rhopalosiphum maidis (corn leaf aphid)
Pathway
rmd04624  Toll and Imd signaling pathway
Brite
KEGG Orthology (KO) [BR:rmd00001]
 09150 Organismal Systems
  09151 Immune system
   04624 Toll and Imd signaling pathway
    113558107
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Death_2 Haspin_kinase APH
Motif
Other DBs
NCBI-GeneID: 113558107
NCBI-ProteinID: XP_026819423
Position
1
AA seq 450 aa AA seqDB search
MILETTEVRKMDATLKFELVNLLDINDGWKSLMAAVTVDCDPMKSRKYTFDHLKLIEMAS
QTQRRSCSEIFLEEWGTSGRIRPNLKILMDLLIELKLIRAAECIASKITSDKPNEKLETS
MNLLEIDEYTNNDNSEDYKSTLFAHQLETRSILNDDKSNTRFDKIKLPYKYLSNATNGFS
DSCLIGAGGFGKVFKAKLINQIVAIKLMEKIIEEKDFKQYLNEIDIVLKFKHDNLLPLIA
ISYDEQPCVVYEFMENGSLLDCIACKNRSSILDWKLRIKIGTDVASGLVYLHTAFETPFI
HRDIKSANILLDNTFIAKIGDFGLTRIGDHTMTSVVLGTSAYMSPEAFRGDISMKIDVFS
FGVVLLELLTGLPPYDECRTGCDLLTHISEIESPIEELLDKRAGYWNNSIAIKMYDLANL
CTATKTQRPFIHGQEGVFESLKNILSEIGV
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgatactggaaaccacagaggtacgtaaaatggatgcaacgctcaaatttgaactggta
aatttattagatattaatgatggttggaaatcacttatggctgctgtaactgttgactgt
gatccaatgaaaagtcggaaatatacttttgatcacttgaaattaatagaaatggcaagc
caaacacaacgaagatcttgtagtgaaatatttttagaagaatggggaaccagtggtcgt
attaggcctaatctcaagatccttatggatctattaatcgaattaaaactaatacgagct
gctgaatgtatagcttctaaaataaccagtgataaacctaatgaaaagttggagacatct
atgaaccttcttgagattgatgaatacacaaataatgataatagtgaagactataaatct
actttgttcgctcatcagctagagaccagatcaattttaaatgatgacaaaagtaataca
aggtttgacaaaattaagctaccttataaatatttatctaatgccacaaatggattttcg
gattcatgtttaattggagctggtggatttggtaaagtattcaaagcaaaattaattaac
caaatagtggcaataaaacttatggaaaaaataatcgaagaaaaagattttaaacagtat
ttaaatgagattgatattgtattaaaattcaaacatgataatttattaccattaatagca
atttcatatgatgaacagccgtgtgttgtttatgaatttatggagaatggttcattactt
gattgcattgcatgtaaaaatagatcttccatattagattggaaactaaggataaaaatt
ggaacagatgtagccagtgggctagtttacttacacacagcatttgaaacacctttcata
catcgagacattaaaagtgctaatatacttctagacaatacatttattgccaaaattgga
gactttggcttaactcgcattggagatcacactatgacatctgtagtgttaggaacatct
gcgtatatgtcacctgaggcatttagaggtgatatctctatgaagatagatgttttcagc
tttggagtagtattattggagctattaacaggattaccaccgtacgatgaatgtcgtact
ggttgtgatttgttaactcatataagtgaaattgaaagtcctattgaagaactattagac
aaacgtgctgggtattggaacaacagtattgctataaaaatgtatgacttggcaaatctt
tgtactgctactaaaacccaaagaccatttatacacggtcaagagggtgtttttgaatct
cttaaaaatattctatctgaaattggtgtataa

DBGET integrated database retrieval system