KEGG   Cupriavidus metallidurans: Rmet_0623
Entry
Rmet_0623         CDS       T00351                                 

Definition
(GenBank) hypothetical protein
Organism
rme  Cupriavidus metallidurans
SSDB
Motif
Pfam: T6SS_VasE
Other DBs
NCBI-ProteinID: ABF07509
UniProt: Q1LQR7
Position
complement(683645..684205)
AA seq 186 aa
MTPQHFQQQALWEQHTNEHTARIASPEPWGTVRVGIDSQALSIHRLMVNALAIRLPDGTV
IDTDTADHTPPARDLADVPSNVDSVVVLIGLPLIDTQGGNCAWGRQGRDKCRTARTGPAL
RIRDTRRLRDLPDRPADAHAARAIRTRSGVRATVPLPVSERPAHRAHAPTLGNPGCQERE
PCCAQA
NT seq 561 nt   +upstreamnt  +downstreamnt
atgaccccgcagcatttccagcagcaagcgctgtgggaacagcacaccaacgagcacact
gcgcgcatcgccagccccgagccgtggggtacggtgcgggtggggatcgattcgcaggcg
ctgtccatccatcgattgatggtcaatgcgctggcgatccgcctgccagatggcacggtg
atcgacacagacactgcggaccataccccacccgcacgcgatctcgccgacgtgccgtcc
aacgtcgacagcgtcgtggtgctgattggcctgcctctgatcgatacgcaaggcggcaac
tgcgcatggggaaggcaaggaagagataagtgtcgaactgcacgcactggccctgctctt
cgaattcgagacacacggcgactacgtgacctgcccgatcgcccggctgatgcgcacgcc
gcaagggcgattcgaactcgatccggtgttcgtgccaccgtgcctcttcctgtcagcgaa
cgaccggctcaccgagcgcatgcgccgactctcggaaatcctggctgccaagagcgcgag
ccttgctgtgcgcaggcgtga

DBGET integrated database retrieval system