KEGG   Cupriavidus metallidurans: Rmet_0636
Entry
Rmet_0636         CDS       T00351                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11895  type VI secretion system protein ImpH
Organism
rme  Cupriavidus metallidurans
Brite
KEGG Orthology (KO) [BR:rme00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rme02044]
    Rmet_0636
Secretion system [BR:rme02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Rmet_0636
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-ProteinID: ABF07522
UniProt: Q1LQQ4
Position
702800..703888
AA seq 362 aa
MSPPKEGPLLRALLANAPQMNFFRLCELIELSVPQRPPLGTTDSLADDPVRFRSNGGLGF
PGREIDLVDYDDDYPDRPPVIRTAFLGLYGVDARMPSYFVDEIAQRRDGAESLAAFLDLF
HHRVVTQFYRVARKYRYPMGFLSGGPDEVSRYLLSLLGLGLREPGAGRPGVEHVEHVEGA
VSPRKLLSMLGLASQRTRTAEGLAGVLQHAVPDAQILVEEFYPVWVRLDATERMPLGENC
VLGRGFYDRANAVRVVITPQTPESVLGLMPGRAMHREVMVLLRFYLGHAAHAHLEMQVRP
ALMPAPALNSNAVSLGYSTQLQCSVATTNANATRGAAITRVQLGTWNGFNAGASAPLSHR
SQ
NT seq 1089 nt   +upstreamnt  +downstreamnt
atgtcacccccgaaggaaggtcccttgttgcgagcgttgctcgccaatgcacctcagatg
aatttcttccgactgtgtgaactgatcgagctgtccgtgccgcagcgcccgccgctgggc
accacggattccctggccgacgacccagtgcgcttccgttccaatggggggcttgggttc
ccggggcgggagatcgatttggtcgactacgacgatgactacccagaccggccaccagtc
attcgcacagccttccttggcctgtatggcgtcgacgcgcgtatgccgtcctacttcgtg
gacgagattgctcagcgtcgtgatggcgcagagtcgctggcggccttcctggacctgttt
caccaccgcgttgtcacgcagttctaccgggtcgcgcgcaagtatcgctatccgatgggt
ttcctgtcgggcggaccggacgaggtttcacgctacctgctcagtctgctcgggctgggg
ctgcgcgagccgggagccgggcggcccggtgtcgaacacgtcgaacacgtcgaaggcgcc
gtcagcccgcgcaaactgttgtcgatgctgggactggccagccagcgcacacggactgct
gagggtcttgccggcgtgttgcagcatgccgtgccggatgcgcagatcctggtggaggag
ttctaccccgtgtgggtgcgcctcgatgccaccgagcgcatgccactcggcgagaactgt
gtgttggggcgaggcttctacgaccgtgccaatgcggtacgcgtggtgatcacgccccag
acgcccgaatcggtgcttgggctgatgccgggtcgggccatgcaccgggaggtgatggtg
ctgttgcgcttctacctcggccatgccgcgcacgcgcatctggagatgcaggtgcggcca
gcgctgatgccggctccggccctgaactcgaatgcggtgagtcttgggtatagcacgcaa
ctccagtgctccgtggccaccaccaacgccaacgcgacccggggagccgcgatcacgcgc
gtgcagttgggaacatggaatggattcaatgccggagcatccgcgcctctaagccatcgc
agtcaatga

DBGET integrated database retrieval system