KEGG   Cupriavidus metallidurans: Rmet_0719Help
Entry
Rmet_0719         CDS       T00351                                 

Gene name
aroA
Definition
(GenBank) 5-enolpyruvylshikimate-3-phosphate synthetase
  KO
K00800  3-phosphoshikimate 1-carboxyvinyltransferase [EC:2.5.1.19]
Organism
rme  Cupriavidus metallidurans
Pathway
rme00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rme01100  Metabolic pathways
rme01110  Biosynthesis of secondary metabolites
rme01130  Biosynthesis of antibiotics
rme01230  Biosynthesis of amino acids
Module
rme_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:rme00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rmet_0719 (aroA)
Enzymes [BR:rme01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.19  3-phosphoshikimate 1-carboxyvinyltransferase
     Rmet_0719 (aroA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase
Motif
Other DBs
NCBI-ProteinID: ABF07605
UniProt: Q1LQH1
Position
796526..797884
Genome map
AA seq 452 aa AA seqDB search
MPPARAARNGHAAENMEQLTLGPLTRASGTVRLPGSKSISNRVLLLSALATGETRVRDLL
DSDDTRVMLEALKVLGVAWRREGNDCIVSGVGGNFPSKAADLFMGNAGTAIRPLTAALAL
QGGTYKLSGVQRMHERPIGDLVDGLRQVGASVDYLGTPGYPPLQINPAQIRIDAPIRVRG
DVSSQFLTALLMTLPMAQAQSGRIEIEVVGELISKPYIEITLNLLSRFGIAVERQGWERF
ILPAGARYRSPGEIYVEGDASTASYFLAAGAIGGGPVRVEGVGMASIQGDVRFADALNRM
GANVMAGDNWIEVRGTERDDGRLNGIELDCNHIPDAAMTLAVAALFAEGTTTLTNIASWR
VKETDRISAMATELRKLGAEVEEGADYLKVTPPTSPATWQTPDAGIGTYDDHRMAMCFSL
AAFGPLPVKINDPGCVAKTFPEYFEVFAGVAR
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgccgccagcgcgcgcggcgcgcaacggccatgctgcagaaaacatggaacaactgacc
ctcggccccctgacccgtgcttccggcacggtgcgcctgcccggctccaagagcatctcc
aaccgcgtgctgctgctgtccgcgctcgccaccggcgaaacgcgcgtccgcgacctgctc
gattccgacgacacgcgtgtcatgctcgaagcgctcaaggtgctcggcgtggcatggcgg
cgcgagggcaacgactgcatcgtgtccggcgtgggcggaaatttcccgagcaaggcggca
gacctgttcatgggtaatgccggcacggcaatccggccattgaccgcggcactggcgctg
caaggcggtacgtacaagctgagcggcgtgcagcggatgcatgaacggccgatcggcgat
ctggtcgatggcctgcggcaggtcggcgcatcggtggattacctgggcacgcccggctac
ccgcctttgcagatcaacccagcgcagattcgcattgatgcaccgatccgtgtgcgcggc
gatgtatcgagccagttcctgaccgcgctgttgatgacgttgccaatggcccaggcacaa
tcgggtcgcattgagatcgaagtggtcggcgaattgatttcgaagccgtatatcgagatc
acgctgaacttgctgtcgcgcttcggtattgccgtcgagagacagggctgggagcgcttt
atcctgccggccggcgcgcggtaccgttcgccgggcgagatctacgtcgaaggcgatgcg
tccacggcatcgtacttcctggcggcgggcgccatcggtggtggcccggtacgcgtggag
ggtgtgggcatggcgagtatccagggcgatgttcggtttgccgatgcgctgaaccggatg
ggcgccaacgtgatggctggtgacaactggattgaagtgcgcggcacagagcgtgacgac
ggccgactcaacggcatcgagctcgactgcaatcacattcctgatgcggcgatgacgctg
gccgtggccgcgctgttcgcggagggcaccaccacgctgaccaacatcgccagctggcgg
gtcaaggaaacggaccgcatctcagcgatggcgacggagctgcgcaagctcggcgcggag
gtggaggagggggctgattacctgaaagtgacgccgccgacctccccggcaacgtggcag
accccggatgctggaattggcacctatgatgaccatcggatggccatgtgtttctcgttg
gccgcattcggcccgttgcccgtgaagatcaacgaccccggctgcgtggcaaagacgttc
cccgagtacttcgaggtatttgccggagtggcgcggtaa

DBGET integrated database retrieval system