KEGG   Cupriavidus metallidurans: Rmet_0775Help
Entry
Rmet_0775         CDS       T00351                                 

Gene name
phnC
Definition
(GenBank) phosphonate/organophosphate ester transporter subunit; ATP-binding component of ABC superfamily
  KO
K02041  phosphonate transport system ATP-binding protein [EC:7.3.2.2]
Organism
rme  Cupriavidus metallidurans
Pathway
rme02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:rme00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Rmet_0775 (phnC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rme02000]
    Rmet_0775 (phnC)
Enzymes [BR:rme01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.2  ABC-type phosphonate transporter
     Rmet_0775 (phnC)
Transporters [BR:rme02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphonate transporter
    Rmet_0775 (phnC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_16 AAA_29 AAA_21 RsgA_GTPase SMC_N AAA_25 NACHT AAA_22 AAA_30 AAA_33 AAA_28 MMR_HSR1 AAA_23 AAA_19 G-alpha
Motif
Other DBs
NCBI-ProteinID: ABF07661
UniProt: Q1LQB5
Position
complement(850968..851897)
Genome map
AA seq 309 aa AA seqDB search
MTPTGVIVLSLSAARMRLSFKEGVDMTHAIEVRGLSKSFRADRKALDDVTLQIAPGEMVA
LLGASGSGKSTLLRHVAGFVTGDAGSGEILVNGRTVQRNGRLARDVRRVRADIGFVFQQF
NLVGRLPVITNVLVGMLTRVPKWRSLLRIFKASEVQAGLDALAQVGIDDYAFQRASTLSG
GQQQRAAIARTLVQNAQVILADEPIASLDPESSRRVMSQLAQINRTRKVAVVVSLHQVDV
AMRYCPRVVALRHGKVVYDGPSAALTQQMLRDLYGSEADELLHDSVPEAPSCAEGVPAPV
MVRMDLAAA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgacgccgaccggcgtcatcgttctgtcactgtcggccgccagaatgcgcctgtcattc
aaggaaggagtcgacatgacgcatgcaattgaagtccgcggactgagcaagtcgttccgc
gcggaccgcaaggcgcttgacgatgtcacgctgcaaatcgccccgggtgaaatggttgcg
ctgctgggcgcatcgggctcgggcaaatcgacgctactgcgccatgtggccggtttcgtc
acgggcgatgccggttcgggcgagatcctcgtcaacggccgcacggtgcagcgtaacgga
cgtctggcccgcgatgtgcgccgtgtacgtgcggacatcggattcgtattccagcagttc
aacctggtcggccgcctgcctgtgatcaccaatgtgctcgtgggaatgctgacgcgcgtg
ccgaaatggcgcagcctgctccgcatcttcaaggccagcgaagtgcaagccggactcgat
gcgcttgctcaggttggtatagacgactatgcgtttcagcgtgcctcgaccctgtcgggc
gggcagcagcaacgtgctgcgatcgcccgcacgctggtgcagaacgcgcaagtgatcctg
gccgacgagccgatcgcctcgctcgatccggaatcgtcgcgtcgcgtgatgtcgcaactg
gcgcagattaaccgcacgcgcaaagtcgccgtggtggtgtcgctgcatcaggtggacgtg
gcgatgcgctattgcccgcgcgtggtggcattgcgtcacggcaaggtggtctatgacggg
ccctccgccgcgctgacgcagcagatgctgcgcgacctgtacggcagcgaggccgacgag
ctactgcacgacagcgtgccagaggccccctcttgcgccgaaggcgtgcccgcgccggtg
atggtcaggatggatctggccgcggcctga

DBGET integrated database retrieval system