KEGG   Cupriavidus metallidurans: Rmet_0925Help
Entry
Rmet_0925         CDS       T00351                                 

Gene name
cbbJ2
Definition
(GenBank) triosephosphate isomerase (cbbJ)
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rme  Cupriavidus metallidurans
Pathway
rme00010  Glycolysis / Gluconeogenesis
rme00051  Fructose and mannose metabolism
rme00562  Inositol phosphate metabolism
rme00710  Carbon fixation in photosynthetic organisms
rme01100  Metabolic pathways
rme01110  Biosynthesis of secondary metabolites
rme01120  Microbial metabolism in diverse environments
rme01130  Biosynthesis of antibiotics
rme01200  Carbon metabolism
rme01230  Biosynthesis of amino acids
Module
rme_M00002  Glycolysis, core module involving three-carbon compounds
rme_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rme00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rmet_0925 (cbbJ2)
   00051 Fructose and mannose metabolism
    Rmet_0925 (cbbJ2)
   00562 Inositol phosphate metabolism
    Rmet_0925 (cbbJ2)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Rmet_0925 (cbbJ2)
Enzymes [BR:rme01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Rmet_0925 (cbbJ2)
Exosome [BR:rme04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Rmet_0925 (cbbJ2)
  Exosomal proteins of bladder cancer cells
   Rmet_0925 (cbbJ2)
  Exosomal proteins of melanoma cells
   Rmet_0925 (cbbJ2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABF07811
UniProt: Q1LPW5
Position
1010940..1011677
Genome map
AA seq 245 aa AA seqDB search
MRQKLVIGNWKMHGSLAANAALLEGIKAAPARAKLAVCAPFPYLAQCQTLLSGSQVAWGA
QDVSSEARGAFTGEVAASMLGEFGCGYALVGHSERRTYHGETDAVVAAKALRALEFDIVP
VVCVGETLAEREAGQTEAVVGRQLQAVLDALSIEQLGRIVLAYEPVWAIGTGKTATSAQA
QEVHAALRARVTAKDAGVAARMAILYGGSVKPDNAAELFSMSDIDGGLIGGASLKADDFL
AIGNA
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
gtgagacaaaagctggtcatcggcaattggaagatgcatggcagcctggccgccaacgcg
gcgctgcttgagggtatcaaggctgcgcctgcgcgcgcgaagctggcggtctgcgcgccg
ttcccctatcttgcccagtgccagacgctgttgtccggttcccaggttgcctggggtgct
caggatgtgtcgtccgaggcccgtggtgccttcaccggtgaagtagctgcctcgatgctg
ggtgagtttggttgcggctatgcgctcgtcggccattcagagcgtcgtacctaccatggt
gaaaccgacgcggtagtggctgccaaggcactgcgcgcgctggaattcgacattgttccg
gtggtctgtgttggagagacgctggccgagcgcgaagccggtcagaccgaagccgtggtt
ggtcgtcagttgcaggctgtactcgatgcgttgtctatcgagcaactgggtcgcattgtt
ctggcctatgagcccgtctgggcgatcggtacgggcaagacggccacgagcgcgcaggcc
caggaagttcatgcggcgctacgtgcgcgggtcacggcgaaggatgccggtgttgcagca
cgcatggccattctgtatggcggtagcgtcaagcccgacaatgcagctgaattgttttcc
atgtccgatattgacggggggcttattggtggcgcctccctgaaggcggatgatttcctc
gcgatcggcaacgcctga

DBGET integrated database retrieval system