KEGG   Cupriavidus metallidurans: Rmet_1197Help
Entry
Rmet_1197         CDS       T00351                                 

Gene name
aceF
Definition
(GenBank) Dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rme  Cupriavidus metallidurans
Pathway
rme00010  Glycolysis / Gluconeogenesis
rme00020  Citrate cycle (TCA cycle)
rme00620  Pyruvate metabolism
rme01100  Metabolic pathways
rme01110  Biosynthesis of secondary metabolites
rme01120  Microbial metabolism in diverse environments
rme01130  Biosynthesis of antibiotics
rme01200  Carbon metabolism
Module
rme_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rme00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rmet_1197 (aceF)
   00020 Citrate cycle (TCA cycle)
    Rmet_1197 (aceF)
   00620 Pyruvate metabolism
    Rmet_1197 (aceF)
Enzymes [BR:rme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Rmet_1197 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H PYNP_C HlyD_D23 DUF4813 HlyD_3 NQRA RnfC_N CAT
Motif
Other DBs
NCBI-ProteinID: ABF08083
UniProt: Q1LP43
Position
1315368..1317032
Genome map
AA seq 554 aa AA seqDB search
MSQAIEIKVPDIGDYDAVPVIEVHVKPGDTINAEDALVTLESDKATMDVPSPQAGTVKEV
RIKVGDSVSEGSVLVMLEPAGAAAAAPAPAAAAAPAAPAPAAAAPAPAAPAAPAPAAAPA
GGGTVEVKVPDIGDYDAVPVIEIHVKVGDQINAEDALVTLESDKATMDVPSPQAGTVKEI
KVKVGDNVAQGTLILILEAAGGAAAAAPAPAAAPAPAAAAPAPAPAAAAPAPVAAPAVAP
AVQGTTGKAAHASPTVRKFARELGVDVSRVPGTAPKGRITQEDVQNYVKSVMSGQTATPS
APAAAAGTGVGLDLLPWPKVDFTRFGEVESKPLSRIKKISGANLHRNWVMIPHVTNCDEA
DITELEAFRVQLNKENEKAGIKVTMLAFMIKATVAALKKFPNFNASLDGDNLVLKKYFNI
GFAADTPNGLVVPVIKDADKKGVLEISQEMSDLAKLARDGKLKPDQMQGGCFSISSLGGL
GGTYFTPIINAPEVAIMGVCKSYMKPVWDGKQFAPRLTLPLSLSWDHRVIDGAEAARFNT
YFAALLADFRRILL
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagcgattgaaatcaaggtgccggatatcggcgactacgacgccgttcccgtc
atcgaagtgcacgtgaagccgggcgacacgatcaacgcggaagacgcgctggtgacgctg
gaatccgacaaggccaccatggacgtgccgtcgccgcaggccggcacggtcaaggaagtc
cggatcaaggtgggcgatagcgtttccgaaggctccgtgctggtgatgctcgagcccgca
ggcgccgctgccgccgctccggctcccgcagccgctgctgctccggcagctccggcccct
gccgccgcggcacccgcgccggcggctcccgctgccccggctccggccgctgcccctgct
ggtggtggcacggtcgaggtcaaggtgcccgatatcggcgactacgacgccgtgccggtc
atcgaaatccacgtcaaggtgggtgaccagatcaacgccgaagacgcgttggtgacgctg
gagtccgacaaggccaccatggatgtgccgtcgccgcaggccggcacggtcaaggaaatc
aaggtcaaggtcggtgataacgtcgcccaaggcacgctgatcctgatcctggaagctgct
ggcggcgctgccgcagcagctccggccccggcagccgccccggcgcctgccgcagccgct
cccgcgcccgcaccggcggccgcggcgccggcacctgttgccgcgccggccgtcgcgcca
gcggtgcagggtacgaccggcaaggccgctcacgccagcccgaccgtgcgcaagttcgcg
cgcgagctgggtgtcgacgtgtcgcgtgtgccgggcaccgctcccaagggccgcatcacg
caggaagacgtgcagaactacgtcaagagcgtcatgagcggccagactgccacgccgtcc
gcaccggctgccgccgccggcaccggcgtgggcctggacctgctgccgtggccgaaggtg
gacttcacgcgctttggcgaagtggagtcgaagccgctgtcgcgcatcaagaagatctct
ggcgccaacctgcatcgcaactgggtcatgatccctcacgtcacgaactgtgacgaagcg
gacatcaccgagctcgaggcattccgcgtgcagctcaacaaggaaaacgagaaggctggc
atcaaggtgacgatgcttgcgttcatgatcaaggccaccgttgcggcgctcaagaagttc
ccgaacttcaacgcctcgctggacggcgacaacctggtgctgaagaagtacttcaacatc
ggtttcgcggccgacaccccgaacggtctggtcgtgccggtgatcaaggacgccgacaag
aagggcgtgctcgagatcagccaggaaatgagcgatctggccaagctggcgcgcgacggc
aagctgaagcctgaccagatgcaaggcggctgcttctcgatctcgtcgctcggcggcctc
ggtggcacgtacttcacgccgatcatcaatgcgccggaagtggccatcatgggcgtgtgc
aagtcgtatatgaagccggtgtgggacggcaagcagttcgccccgcgcctgacgctgccg
ctgtcgctgtcgtgggatcaccgcgtgatcgacggtgccgaggccgcacgcttcaacacg
tacttcgcggcgctgctggcggatttccgccggattctgctgtaa

DBGET integrated database retrieval system