KEGG   Cupriavidus metallidurans: Rmet_1244Help
Entry
Rmet_1244         CDS       T00351                                 

Gene name
yupB
Definition
(GenBank) F plasmid protein 32-like protein (CMGI-2)
Organism
rme  Cupriavidus metallidurans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF932
Motif
Other DBs
NCBI-ProteinID: ABF08130
UniProt: Q1LNZ6
Position
1367383..1368390
Genome map
AA seq 335 aa AA seqDB search
MTAPVRALLTVAGDELRKDGGNRANRVPRADRTEQPKGWASESRNPVCGVNSKPLFVRRK
TMQLASRFASRSPALRSDYPLSDDQIRRVAPSIFADAPHESRSERYSYIPTATVLQELRG
EGFEPFMVTQTRVRHDDRRDYTKHMIRLRHASQINGREANEIILLNSHDGTSSYQMLAGM
FRFVCSNGLVCGDTVADVRVPHKGDVAGHVIEGAYEVLHGFDRVQESRDAMRAITLDAGE
SEVFARAALALKYDEDKPAPITESQILMPRRHDDDRRDLWSVFNRTQENLTKGGLSARAA
NGRRQTTRPVQGIDQSVRLNRALWLLADGLRQLKA
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
ttgacggcccccgtccgcgcgctcctgaccgtcgcgggcgatgaactcaggaaagacggt
ggcaacagggccaaccgggttcctcgtgccgaccgcaccgaacagccaaaaggctgggct
tccgaatctaggaatccggtgtgcggtgtgaacagcaaacctctttttgtcaggagaaag
accatgcaactcgcatcccgtttcgcttcccgctccccggcactgcgcagcgattaccca
ctgtccgatgaccaaatccgcagggtggccccgtccatcttcgccgacgccccgcacgaa
agccgttccgagcgatacagctacatccccaccgcgaccgtcctgcaagaactgcgcgga
gaaggtttcgagcctttcatggtgacgcaaacccgcgtgcgccacgacgaccgccgcgac
tacaccaagcacatgatccggctgcgccacgccagccagatcaacggccgcgaggccaac
gaaatcatcctgctgaactcccatgacggcaccagcagctatcagatgctggccgggatg
ttccgcttcgtttgcagcaatggccttgtctgcggcgacaccgtggccgacgtgcgcgtg
ccgcacaagggcgacgtagccgggcacgtcatcgaaggcgcttacgaagtcctgcacggc
ttcgaccgggtgcaggaatcgcgcgatgccatgcgcgccatcacgctcgacgccggggaa
tcggaagtgttcgcccgcgctgcgctggcgttgaagtacgacgaggacaagccagcgccc
atcacggaatcgcaaatcctgatgccgcgccgccatgacgacgaccgccgcgacctgtgg
agcgtgttcaaccgcacgcaggagaacttgaccaaaggcggcctgtccgcccgcgccgcg
aatggccgccgccagaccacccggcccgtgcagggcatcgaccaaagcgtgcgcctgaat
cgcgccctgtggctgctggccgatggcctgcgccagttgaaagcctga

DBGET integrated database retrieval system