KEGG   Cupriavidus metallidurans: Rmet_1255Help
Entry
Rmet_1255         CDS       T00351                                 

Gene name
parA
Definition
(GenBank) ATPase involved in plasmid partitioning
  KO
K03496  chromosome partitioning protein
Organism
rme  Cupriavidus metallidurans
Brite
KEGG Orthology (KO) [BR:rme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rme03036]
    Rmet_1255 (parA)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rme04812]
    Rmet_1255 (parA)
Chromosome and associated proteins [BR:rme03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    Rmet_1255 (parA)
Cytoskeleton proteins [BR:rme04812]
 Prokaryotic cytoskeleton proteins
  MinD / ParA class of bacterial cytoskeletal proteins
   Rmet_1255 (parA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_31 CbiA MipZ ParA CBP_BcsQ ArsA_ATPase VirC1 CLP1_P AAA_33 AAA_25 Fer4_NifH Methyltransf_24 MobB APS_kinase MeaB AAA_16 ABC_tran NACHT AAA
Motif
Other DBs
NCBI-ProteinID: ABF08140
UniProt: Q1LNY6
Position
1376971..1377609
Genome map
AA seq 212 aa AA seqDB search
MIVALLNQKGGVGKTTLATHIAGELAMRGQHVVLLDADPQGSSLDWTQRRSQQGLPRLFS
AVGLARETLHQEAPELAKRADHVVIDGPPRIAALARSALLAAERVLIPVQPSPYDLWASA
EMVALIREAQVFRPALRAAFVINRRVSTTVIGREARQALADQPLPALRAEVHQRIVFADS
VAAGRLARETAPDSAAAREITALVDELLRWPT
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtcgctctgctcaaccagaaaggcggcgtgggcaagaccacgctcgccacgcac
atcgccggcgagctggcgatgcgcggccagcacgtcgtcctgctggacgccgacccgcag
ggttcatcgctggactggacacagcgcagaagccaacaaggcttgccgcggctgttcagc
gccgtgggcctcgcacgcgaaacgctgcaccaagaggcgccagaactcgccaagcgggcc
gatcacgtcgtcatcgacggcccgccgcgcatcgcggcgctggcgcgctccgcgcttctg
gcggccgagcgcgtgctgatcccggtgcagcccagtccctacgacctgtgggccagcgcc
gagatggtggcgctgatccgcgaagcgcaggtgtttcggcccgcgctgcgcgcggccttc
gtcatcaaccggcgcgtcagtaccaccgtgatcgggcgcgaagcgcgccaggcgctggcc
gaccagccgcttcctgcgctgcgcgcggaagtgcatcagcgcatcgtgttcgccgacagc
gtggccgctggccggcttgcacgcgagacggcgccggacagcgccgccgcgcgcgaaatc
actgcgctggtggacgaactgctgcggtggccgacatga

DBGET integrated database retrieval system