KEGG   Cupriavidus metallidurans: Rmet_1267Help
Entry
Rmet_1267         CDS       T00351                                 

Gene name
oprN
Definition
(GenBank) Outer membrane efflux family protein precursor
Organism
rme  Cupriavidus metallidurans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OEP
Motif
Other DBs
NCBI-ProteinID: ABF08152
UniProt: Q1LNX4
Position
complement(1389124..1390662)
Genome map
AA seq 512 aa AA seqDB search
MKSKPRTPFLRATVTGLTPGRARPLALALSCVLLTACASVGPDYREPPPVDVGSGWSLPL
ASESQSADLSQWWSALDDPILDRLMATALAQNLDLRQAAARIDEARALRDRVAGEALPTA
AAGASVNRRRQSENGPLPVGSIPGLDATQTIYDAGFDAAWEADLFGAKRRALEGANARLQ
ATEAEAQGIRMRIVAEVARTWFTAVGARYELHAQQATLDTLQQTWELVRLRHALGDASTA
DVEAAYAQWTAVNALIPDIQARQRAAVLSLGVLLGAPPERELALLDGPLTPSTLRALPVG
ERADMLRRRPDVLAAERRLAASSADIGVATAELFPKLSIGVGGGFQALSTGDWFDASSSR
FSILPLISWRLFDGGRVRAEIRAREAGQRQAALAYEQAVLAALGDAERALGDYHGGLDTL
ERRGMALDAARTSYGHAKARYAAGDIALVELLAAQRSLHEAETAAARAHTNAAVQLVALY
KALGGGWDVSTAASSATHLLRGTAAPVAFSSR
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgaaatccaagccccgcactccctttcttcgcgcaaccgtcaccggcctgacccctggg
cgcgcgcgtccgctcgcgctggccctgtcctgcgtgctgctgactgcctgcgcaagcgtg
ggccccgactaccgcgagccgccgccggtcgacgtcggcagcggctggagcttgccgttg
gcaagcgaatcccagtccgcagacttgagccaatggtggtctgcactggacgatcccatc
ctcgatcgcctgatggccacggcgctggcacagaacctggatctgcgccaggctgcggca
cgcatcgatgaggcacgcgccctgcgcgatcgtgtggccggcgaggcattgcccaccgcc
gccgctggcgcgagcgtcaaccggcgccgtcaaagcgagaacggccccttgcccgtaggc
tcgatccccggccttgacgccacgcagaccatctacgacgcgggcttcgacgcggcctgg
gaggccgacttgttcggggccaagcggcgcgccctggaaggcgccaacgcccgcctgcag
gcgaccgaagccgaggcacagggcatacgcatgcgcatcgtggccgaggtcgcgcgcacc
tggttcaccgccgtcggcgcccgctacgagttgcacgcacaacaggccacgctggatacg
ctgcagcagacttgggaattggtgcgccttcggcatgcgctgggcgacgcgtcgaccgcc
gacgtggaggcggcgtacgcccaatggacagcagtcaacgcgctcatcccggatatccag
gcgcgccagcgcgccgcggtactcagcctgggcgtgctgctgggcgcaccgccggagcgg
gagctggcactgctggatggccccttgacgccgagcacgctgcgggcgctgccggtgggc
gagcgtgccgacatgctgcgccggcgccctgacgtactggctgcggaacgtcgcctggcg
gcgagttctgccgacatcggcgtggccacggccgagttgttccccaaactctccattggt
gtcggcggcgggttccaagcgctcagtacgggcgattggttcgatgcatccagttcgcgt
ttttccatcctgccgctgatttcctggcgcctgttcgacggcggccgcgtgcgcgccgag
attcgggcgcgcgaggcggggcagcggcaggccgcgctggcctacgagcaggccgtgctg
gcggcgctgggcgacgccgaacgcgcgctgggcgactaccacggcgggctggacacactg
gaacgccgtggcatggcactggatgccgcgcgcacaagctacggccacgccaaggcgcgc
tacgcggcgggcgacattgcactggtcgaactgctggccgcccagcgaagcctgcacgag
gccgaaaccgcagcggcacgcgcgcataccaacgccgccgtgcaattggtggcgctgtac
aaggcccttggtggcggctgggacgtatccacggcggcatccagcgcaacccatctgctg
cggggcactgccgcccccgtcgcgttttcaagccgctga

DBGET integrated database retrieval system