KEGG   Cupriavidus metallidurans: Rmet_1290Help
Entry
Rmet_1290         CDS       T00351                                 

Gene name
hoxQ
Definition
(GenBank) HoxQ protein involved in nickel incorporation into hydrogenase-1 proteins(belongs to CMGI-2)
  KO
K03618  hydrogenase-1 operon protein HyaF
Organism
rme  Cupriavidus metallidurans
Brite
KEGG Orthology (KO) [BR:rme00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    Rmet_1290 (hoxQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HupH_C
Motif
Other DBs
NCBI-ProteinID: ABF08175
UniProt: Q1LNV1
Position
complement(1408127..1408990)
Genome map
AA seq 287 aa AA seqDB search
MKAFPIPVVALGPGTQTEDEHLDYLPMPKDMDTYRAPMLPEPEEIAGRTAAREALAQVLA
LLDQAAEGAPGGQVGLLSLSPEDRQLVNQVMGEGEASAIVREESSSLEVRIQESVFAGVW
RIMSFNGSVLVDDVIEVGPVPMQLRITADEDAESLYRPWRGLLPANVQNAPLLVEEIRDQ
IARWQPGQPPHVVNLTLLPVTPEDIAYLDHQLGTGRVLLLSRGYGNCRITNTRHPHCWRV
VYYNSMDSVILNTVEVVDMPEVAMAAPEDLRDSHERLADVLGYLEQA
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccttccccattcccgtcgtcgccctcggccccggcacccagaccgaggacgag
cacctcgactacctgcccatgcccaaggacatggacacctaccgcgcgcccatgctgcct
gagccggaggaaatcgccggtcgcacggctgcgcgcgaggccctggcccaggtgctggcg
ctgctggaccaggccgccgagggggcgcccggcgggcaggtgggtctgctgtcgctgtcg
ccggaagaccggcagctggtcaaccaggtgatgggcgagggcgaggccagcgccatcgtg
cgcgaggagtcctcgtcgctggaagtgcgcatccaggagtcggtgttcgccggtgtctgg
cgcatcatgagtttcaacggcagcgtgctggtggacgatgtgatcgaggtcggccccgtg
cccatgcagctgcgcatcacggccgacgaagacgctgagagcctctaccgtccctggcgg
ggtctcttgcctgccaatgtacagaacgcgccgctgctggtcgaagagatccgcgaccag
atcgcgcgctggcagccaggccaaccgccgcacgtggtcaatctcacgctgctgccggtg
acaccggaagacatcgcctacctcgaccaccagctgggcaccggccgcgtgctgctgctc
tcgcgcggctatggcaactgccgcatcaccaacacccggcacccgcactgctggcgcgtc
gtctattacaactccatggacagcgtgatcctcaacaccgtcgaggtggtcgacatgccc
gaggtggccatggcggcaccggaagacctgcgcgattcgcacgaacgcctggccgacgtg
ctgggctatcttgagcaagcctga

DBGET integrated database retrieval system