KEGG   Cupriavidus metallidurans: Rmet_1296Help
Entry
Rmet_1296         CDS       T00351                                 

Gene name
hupE
Definition
(GenBank) HupE putative membrane-bound hydrogenase component hupE HupE/UreJ protein precursor (modular protein)Uptake hydrogenase (belongs to CMGI-2)
  KO
K03192  urease accessory protein
Organism
rme  Cupriavidus metallidurans
Brite
KEGG Orthology (KO) [BR:rme00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    Rmet_1296 (hupE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HupE_UreJ
Motif
Other DBs
NCBI-ProteinID: ABF08181
UniProt: Q1LNU5
Position
complement(1411714..1412451)
Genome map
AA seq 245 aa AA seqDB search
MSPRLRRFASSPRRGDAPGGPAEPVPRVPWTRPPHRHEQTTRRTTMKKQTARGLMAATLL
AGVAGAAQAHTGHGTSSLFEGLVHPFGPDHLLAMVAVGVWSVSALPANKAWQGPAVFLLA
LIASATLGMLGVTVPYLEHGVSLSVVMFGAMLLLAGRASVPPAVGLGLIAAAASLHGLAH
GSETPESGFAGYAIGFLLTTAVLHLGGVGIGLGIRRWLAERSGWVLSGLGAMLSAAGLYL
FGQLA
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgagcccccgcctgcggcgcttcgcgtcttccccccgaaggggggacgcacctggtggt
ccggcggagccggttccaagggtgccctggacaagaccgccgcaccgccatgaacagaca
acgaggagaacaacgatgaagaaacagacagcgcgcggcctgatggccgccaccttgctc
gccggcgtggccggcgccgcacaggcccacaccggccacggcaccagcagcctgttcgaa
ggcctggtgcaccccttcggtcctgaccacctgctggccatggtcgccgtgggtgtgtgg
tcggtctcggcgctgcccgcgaacaaggcctggcaaggtccggccgtgttcctgctggcg
ctcattgcgagcgcaacgctgggcatgctcggcgtgacggtgccgtacctggagcacggg
gtctcgctctccgtggtgatgttcggtgccatgctgttgctcgcagggcgtgccagcgtg
ccacccgcggtgggcctggggctgatcgccgcagccgcttcgctgcacggcctggcacac
ggctccgaaacgccggagagcggtttcgccggctatgcgatcggcttcctgctcaccaca
gcggtgttgcacctgggcggtgtcggcatcggcctgggcattcggcgctggctggccgag
cgcagcggttgggtgctcagcggcctgggcgccatgctgagcgcggcgggcctttacctg
ttcggccagctcgcctga

DBGET integrated database retrieval system