KEGG   Cupriavidus metallidurans: Rmet_1305Help
Entry
Rmet_1305         CDS       T00351                                 

Gene name
patR
Definition
(GenBank) transcriptional regulatory protein with helix-turn-helix motif, Fis-type (belongs to CMGI-2)
Organism
rme  Cupriavidus metallidurans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma54_activat XylR_N Sigma54_activ_2 V4R HTH_8 AAA AAA_5 AAA_16 HTH_1 AAA_22 HTH_30 HTH_28 Hpr_kinase_C AAA_2 RsgA_GTPase AAA_24 HTH_20 NB-ARC
Motif
Other DBs
NCBI-ProteinID: ABF08190
UniProt: Q1LNT6
Position
complement(1419138..1420982)
Genome map
AA seq 614 aa AA seqDB search
MKEEKGKAGEIDRGIPLFVPDVVADLHFPDIRDLAERLRFNPADGRIWLDDRRMVLIHTD
AFASLRQELIEALGSDAARGLLTRMGYLSGSRDAALARKVRGQDSAFDAFAVGPQLHALE
GIVLVEPVRVDIDSTTGQYYGEFLWKDSSEDEAHISVYGIGSEPACWMQIGYACGYTSAF
MGRRILYREVECRAMGNTLCRIIGKPVDEWDAPDADLRYMLPQSLEKRRFVALKSSGPAP
TDSTDHECVPCKPDEVPVKEGPIGASAGFNAVMHKIFRVAPTSATVLLMGESGVGKSLFA
RELHNRSSRVGKPFVELNCAALPDSLIESELFGVERGAFTGASDARVGRFESANEGTIFL
DEIGNLSLTAQAKLLRVLQTGEMEHLGSSKTVKVNVRVITATNDNLKQAIKSGRFREDLF
YRLNVFPIVIPPLRERKDDIPVLLEFFIKKFSKRHGRSLKGLSNRALHLLLDYSWPGNIR
EMENVLERGVILAEEGGTLDVCHLFSSGDTVECKGAFGLSDLGSLALDSISTSAPPETIR
KSGEAPEGLEDWAALAVQMNKATLCEVEDALVRAALKAANGNISEAARLLGLTRAQLDYR
VKKLNNSMPISTEK
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaggagaaagggaaagcgggagaaatagacagaggaataccgcttttcgtgcca
gatgtagtggctgatctgcattttccggacattcgggatctggcggaacggcttcgtttc
aatcctgcggacggtcgcatctggctcgacgatcgtcgaatggtcttgatccatacggac
gcgtttgcttcactgcgacaggaactcatcgaagctttaggtagcgatgctgcgcgcgga
ttgctgacccgcatgggatatctatcgggttctcgggatgccgcgctcgcacgaaaggtt
cgcgggcaagacagcgcatttgatgccttcgcggtaggtcctcaacttcacgccctggaa
ggcatcgtcctggtagaacctgtcagagtggatatcgacagcaccaccggtcagtattac
ggggaatttctgtggaaagactcgtccgaggatgaggctcacatatccgtgtacggcatc
ggctccgaaccagcctgctggatgcagattggctacgcgtgcggctacacgagcgctttc
atgggccggcgtattctataccgggaagtcgaatgccgcgcgatgggcaatacattatgt
cgaatcattggaaagcccgtggacgagtgggacgcccccgatgcggatcttcggtatatg
ctgccacaatctctggagaaacgtcgctttgtcgcgttgaaaagttcagggccagccccg
actgactctacagatcatgagtgtgtgccttgcaagcctgacgaagtgcctgtcaaagaa
ggaccaataggggcgtctgctggattcaacgcagtgatgcacaaaatattcagagtggct
cccactagtgcgaccgttttactgatgggcgagagcggcgtgggcaaaagcctgtttgct
cgggaactgcacaacagaagttcgcgtgtagggaaaccattcgttgaattaaattgtgca
gctcttcccgattcgctgattgaatcggagctttttggtgtggagcgaggggcattcacc
ggcgcatccgatgcccgcgttgggcgtttcgaaagcgcaaacgaagggaccatttttttg
gatgagattggtaatctcagtctaaccgctcaagcgaagctattgagagttttgcaaacg
ggggagatggagcacctcgggagttcaaagacggttaaggtaaatgttcgggtaattact
gcgactaatgacaacctcaaacaggcgataaaaagcgggcgttttcgtgaggatcttttc
taccggctgaatgtatttccaattgttattccacctttgcgtgaaagaaaggatgatatc
ccggttttgctggaatttttcataaagaaattttcaaaaaggcatggtcggtccctcaag
ggcttatccaatcgtgcgcttcatctattgctggattactcgtggcccgggaatatccgc
gagatggaaaatgtgctcgaacgtggcgttatcctcgccgaggaaggcggtacgctcgat
gtatgccacttgtttagtagcggtgacaccgtggaatgtaagggtgcttttggtttaagc
gaccttgggtcgcttgccctcgattccatatcgacgagcgctccccccgagacgatccgc
aagagcggagaagccccggaggggctcgaggattgggcagcgcttgctgtacagatgaac
aaagcgacactttgcgaggtcgaagatgcgctcgtacgcgcggcactcaaagccgcgaac
gggaacatatcagaagccgcacgtcttctcggattgacacgcgcgcaactcgactaccgt
gtcaagaagttgaacaattcaatgccaatctcgacggagaagtag

DBGET integrated database retrieval system