KEGG   Cupriavidus metallidurans: Rmet_1307Help
Entry
Rmet_1307         CDS       T00351                                 

Definition
(GenBank) membrane protein precursor involved in aromatic hydrocarbon degradation (TbuX/FadL-like)(belongs to CMGI-2)
  KO
K06076  long-chain fatty acid transport protein
Organism
rme  Cupriavidus metallidurans
Brite
KEGG Orthology (KO) [BR:rme00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rme02000]
    Rmet_1307
Transporters [BR:rme02000]
 Other Transporters
  Pores ion channels [TC:1]
   Rmet_1307
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toluene_X OmpA_membrane DUF3996
Motif
Other DBs
NCBI-ProteinID: ABF08192
UniProt: Q1LNT4
Position
complement(1422721..1424115)
Genome map
AA seq 464 aa AA seqDB search
MKINQSCVAVRVIVVFSVALFAMGTAKATDVFNLEGYGPVSRAMGGTGVAYDIGAAAMMT
NPATLGLMEQGAYLDFGLDVINTDINIRNAATGESVSSGNHGNNNGPYFAPEAAFVYRAG
KYAFGVGAFAGGGLGTQYGGSSFLSRTTTNGINTGFDNFSRLLVLRIPFAMSYDVTDKLT
VGGSLDAVWTSLNLGMLLDASQIGTLAAQHRASGTLLPALASVPGLSGGYINSAHNGIVG
GGADAWGIGGKLGLTYRLTPDTVFGLAYNFKTRVGDLGGHATLSAVSSVAGNIPLDGQIT
VHSFEMPAQFTAGISHRLNDHWSVSADYQRVFLASVFKDINVSFVQSGTGANLNLSLPQN
YRDINVFGVGAEYRYNASLAFRAGFHYAQEAIPNNMLLAVIPAIPTTTLTGGVSYAFSQN
SKIDLGISFALQKTLTNTSQPNTSVPIKVTHSQINAAVAWQKRF
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
ttgaagatcaatcagagttgtgtcgctgtgcgggtgatcgtggttttttcggtcgcgtta
tttgcgatgggcactgcgaaggctactgacgtgttcaatctggagggctatggccccgtg
tcccgcgccatggggggcacaggcgtggcgtacgacattggcgcggccgccatgatgacg
aacccggcgacgctgggcttgatggagcagggggcctatctagatttcgggctggatgtc
atcaacaccgatatcaacatacgaaacgccgccaccggggaatcagtttcttctggcaat
cacggcaacaacaacggcccctacttcgcgcccgaagccgcattcgtgtatcgggccggg
aagtatgcattcggcgtgggggccttcgcgggagggggactcggcacgcagtacggcggc
agcagctttctgtcgcgcacgaccaccaacggcatcaacaccggcttcgacaatttttcg
cgtctcctggtgttgcgcattccgtttgccatgtcttacgacgtcacggacaagctgacg
gtcggcggctcgctcgacgcggtctggacctcgctgaatctcggcatgctgctggatgcc
tcgcagatcggtacgctcgcggcccagcaccgcgcgtccggcacgctgctgcccgcgctc
gccagcgtgccaggcctgtcgggcgggtatatcaactccgcgcataacggaatcgtgggc
ggcggtgccgatgcctgggggatcggcggcaagctgggcctcacgtatcgcctcacgccg
gacaccgtgtttggcctggcctacaacttcaagacgcgcgtgggcgatctgggcggccat
gcaacgttgtcggcagtaagttccgttgccggaaacatcccgctcgacggtcagatcacg
gtccacagcttcgaaatgcccgcgcagttcacggcaggtattagtcaccggttaaacgat
cactggagcgtttcggccgactatcagcgcgtgtttctcgcgagcgtgttcaaggacatc
aacgtgagcttcgtgcagtcgggcacgggggcgaacctgaacctgtcgctgccgcagaac
taccgtgacatcaacgtgtttggcgtgggggcggaataccgctacaacgcgagcctcgcg
ttccgtgcgggcttccattatgcgcaggaagccatacccaacaatatgctgttggccgtc
attcccgccatcccgaccacgaccctgaccggcggcgtctcttatgcgttcagccaaaac
agcaagatcgacctcggcatatcattcgcactgcagaagaccttgacgaacacgagtcag
cccaacacctccgtgccgataaaggtgacccactcgcagatcaacgcagcggtggcctgg
caaaaacggttttga

DBGET integrated database retrieval system