KEGG   Cupriavidus metallidurans: Rmet_1313Help
Entry
Rmet_1313         CDS       T00351                                 

Gene name
tmoD
Definition
(GenBank) Toluene-4-monooxygenase system protein D
  KO
K15763  toluene monooxygenase system protein D [EC:1.14.13.236 1.14.13.-]
Organism
rme  Cupriavidus metallidurans
Pathway
rme00623  Toluene degradation
rme01100  Metabolic pathways
rme01120  Microbial metabolism in diverse environments
rme01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rme00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00623 Toluene degradation
    Rmet_1313 (tmoD)
Enzymes [BR:rme01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.236  toluene 4-monooxygenase
     Rmet_1313 (tmoD)
    1.14.13.-  
     Rmet_1313 (tmoD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MmoB_DmpM
Motif
Other DBs
NCBI-ProteinID: ABF08196
UniProt: Q1LNT0
Position
complement(1429148..1429462)
Genome map
AA seq 104 aa AA seqDB search
MTKNDIASAHFNNRVGPVMRAGELAEAVVEAAREDNPGKEIRVDDKRAYLRIDTDGELIL
RRETIERALGRPFKMPDLEVELSSFAGRIETMPDQVRFYFEKQV
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
gtgactaaaaacgatattgcatcggcccactttaacaacagggtgggtccggtcatgcgt
gctggcgagctcgctgaggcagtagttgaggcagcgcgagaggacaaccctggcaaggaa
attcgcgtggacgacaagcgcgcctatttgcgcatcgacaccgacggggagttaatcctg
cgccgcgaaacgattgagcgggcgctgggccggccgttcaaaatgcctgacctcgaggtt
gaattgagttcgtttgccgggcgtattgaaactatgcccgatcaggtccgcttctacttt
gagaagcaagtctga

DBGET integrated database retrieval system