KEGG   Cupriavidus metallidurans: Rmet_1317Help
Entry
Rmet_1317         CDS       T00351                                 

Gene name
nahJ
Definition
(GenBank) 4-oxalocrotonate tautomerase family enzyme (protein belongs to CMGI-2)
  KO
K01821  4-oxalocrotonate tautomerase [EC:5.3.2.6]
Organism
rme  Cupriavidus metallidurans
Pathway
rme00362  Benzoate degradation
rme00621  Dioxin degradation
rme00622  Xylene degradation
rme01100  Metabolic pathways
rme01120  Microbial metabolism in diverse environments
rme01220  Degradation of aromatic compounds
Module
rme_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:rme00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Rmet_1317 (nahJ)
   00622 Xylene degradation
    Rmet_1317 (nahJ)
   00621 Dioxin degradation
    Rmet_1317 (nahJ)
Enzymes [BR:rme01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.2  Interconverting keto- and enol-groups
    5.3.2.6  2-hydroxymuconate tautomerase
     Rmet_1317 (nahJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tautomerase Tautomerase_2 Tautomerase_3 DUF5380
Motif
Other DBs
NCBI-ProteinID: ABF08200
UniProt: Q1LNS6
Position
complement(1431791..1431982)
Genome map
AA seq 63 aa AA seqDB search
MPIAQLYIIEGRDAEKKERLIAEVTEAIHRAIDAPVESIRVLITEMPKEHFGIAGQSARK
RGR
NT seq 192 nt NT seq  +upstreamnt  +downstreamnt
atgccgattgcgcagctgtacatcatcgaaggccgcgatgcggaaaagaaggagcggctg
atcgccgaggtcaccgaggcgatccatcgcgcgattgatgcgccggtggagtccatccgc
gtgctcattaccgaaatgccgaaagaacactttggaatcgcgggtcaaagcgccaggaaa
cgagggcgttag

DBGET integrated database retrieval system