KEGG   Cupriavidus metallidurans: Rmet_1319Help
Entry
Rmet_1319         CDS       T00351                                 

Gene name
bphI
Definition
(GenBank) 4-hydroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic acid aldolase, class I 4-Hydroxy-2-oxovalerate aldolase (protein belongs to CMGI-2)
  KO
K18365  4-hydroxy-2-oxovalerate/4-hydroxy-2-oxohexanoate aldolase [EC:4.1.3.39 4.1.3.43]
Organism
rme  Cupriavidus metallidurans
Pathway
rme00362  Benzoate degradation
rme00621  Dioxin degradation
rme00622  Xylene degradation
rme01100  Metabolic pathways
rme01120  Microbial metabolism in diverse environments
rme01220  Degradation of aromatic compounds
Module
rme_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:rme00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Rmet_1319 (bphI)
   00622 Xylene degradation
    Rmet_1319 (bphI)
   00621 Dioxin degradation
    Rmet_1319 (bphI)
Enzymes [BR:rme01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     Rmet_1319 (bphI)
    4.1.3.43  4-hydroxy-2-oxohexanoate aldolase
     Rmet_1319 (bphI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm
Motif
Other DBs
NCBI-ProteinID: ABF08202
UniProt: Q1LNS4
Position
complement(1432779..1433825)
Genome map
AA seq 348 aa AA seqDB search
MNLQGKKITVHDMTLRDGMHPKRHMMTLEQMKSIACGLDAAGVPLIEVTHGDGLGGSSVN
YGFPAHSDEEYLGAVIPLMKQAKVSALLLPGIGTVDHLKMAKELGVHTIRVATHCTEADV
SEQHIALARKLEMDTVGFLMMAHMNSPEGLVGQAKLMESYGANCVYITDSAGYMLPDDVR
ARLGAVREALKPETELGFHGHHNLAMGIANSIAAVECGATRIDAASAGLGAGAGNTPMEV
LVAVCDRMGIQTGVDVWAIQDVAEDLVVPIMDFPIRIDRDSLTLGYAGVYGSFLLFAKRA
ERKYGVPAREILVELGRRGMVGGQEDMIEDTAITLAKARASKAQKVAA
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgcaaggaaaaaaaatcaccgtccacgacatgacgttgcgtgacggcatgcat
ccgaagcgccatatgatgacgctggagcaaatgaaaagcatcgcctgcggcctggacgca
gccggggtccccctgattgaagtcacgcacggcgatggcctgggcggctcgtcggtcaac
tatggctttccggcccacagcgatgaagaatatctgggggccgtgatcccgctcatgaag
caggccaaggtctcggctttactgttgccgggcatcggcacagtcgaccatctgaagatg
gccaaggagcttggcgtgcacaccatccgggtggctacgcactgcaccgaggctgacgtg
tcggagcagcacattgccctggcgcgcaagcttgagatggacacggtgggcttcctgatg
atggcgcatatgaacagtcctgaagggctggtcgggcaggcaaagctgatggagtcgtac
ggcgccaactgtgtttacattaccgattcggctggctacatgctgcccgatgatgtcagg
gcccgccttggcgcggtgcgtgaggcgctcaagccggagacggaactgggctttcacggc
caccacaacctggcgatggggatcgccaactccattgcggccgttgagtgtggcgccacc
cgcatcgacgccgcctcggctggtctcggtgcgggtgcgggcaacacgccgatggaggtc
ctggtcgccgtatgcgaccgaatggggattcagaccggagtggatgtgtgggccattcag
gacgtggccgaagacctggttgtgccgatcatggacttccccatccggatcgaccgcgac
tcgctcaccctgggttacgccggggtctacgggtcgttcctgctgtttgccaagcgcgcc
gagcgaaagtatggcgtaccggcgcgcgagatcttggtcgagcttgggcgccggggcatg
gtcggtggccaggaagatatgattgaagacacggccatcacgctggccaaagcgcgtgcg
tcaaaggcgcagaaggtggcggcatga

DBGET integrated database retrieval system