KEGG   Cupriavidus metallidurans: Rmet_1325Help
Entry
Rmet_1325         CDS       T00351                                 

Definition
(GenBank) Ferredoxin (protein belongs to CMGI-2)
Organism
rme  Cupriavidus metallidurans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2
Motif
Other DBs
NCBI-ProteinID: ABF08208
UniProt: Q1LNR8
Position
complement(1438631..1438987)
Genome map
AA seq 118 aa AA seqDB search
MTTQDGKVYVTVKQTGERFSCALGESLLAGMARLGRRGIPVGCLSGGCGVCKVAVCRGSV
RKTGAMSRAHISEAEEAQGVVLACRVAPTDDVELEVVGKMQKPFFKGLSFQVAQDSTK
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
gtgactactcaggacgggaaggtctacgtgaccgtcaagcagaccggcgagcgtttcagc
tgcgctctcggtgagtctctgcttgccggcatggcacgccttgggcgtcgcggcatacca
gttggttgccttagcggcgggtgcggggtgtgtaaggtcgcagtgtgcagaggcagcgtg
cgcaaaacaggagcaatgagccgtgcgcacatttccgaggcggaagaagcgcaaggtgtg
gtgctggcgtgccgggtggcgcccactgatgatgtagaactggaggtggtcggcaagatg
caaaagccctttttcaaagggttgagctttcaggtagcccaagattcaacgaaataa

DBGET integrated database retrieval system