KEGG   Cupriavidus metallidurans: Rmet_1343Help
Entry
Rmet_1343         CDS       T00351                                 

Gene name
trbD
Definition
(GenBank) conjugal transfer TrbD transmembrane protein (protein belongs to CMGI-2)
  KO
K20529  type IV secretion system protein TrbD
Organism
rme  Cupriavidus metallidurans
Pathway
rme02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:rme00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Rmet_1343 (trbD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rme02044]
    Rmet_1343 (trbD)
Secretion system [BR:rme02044]
 Type IV secretion system
  Trb secretion system protein
   Rmet_1343 (trbD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VirB3
Motif
Other DBs
NCBI-ProteinID: ABF08226
UniProt: Q1LNQ0
Position
1452185..1452457
Genome map
AA seq 90 aa AA seqDB search
MSGPDTFAAGFEVPLHRSLTEPILLGGAPRTVAIANGTLAAAVGLGLQLWIPGVVLWIVG
HSLAVWGARVDPQFMAVFARHIKHRPLLDV
NT seq 273 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcccggataccttcgcggctgggttcgaggtgccgctgcatcgctcgctgacc
gagccgatcctgctgggcggtgcgccgcgcaccgtggcaatcgccaacggcacgctggcc
gccgccgtcgggctaggcctgcaactgtggattcctggcgtcgtgctctggatcgtcggc
cattcgctggcggtatggggcgcgcgcgtcgatccgcagttcatggccgtgttcgcccgg
cacatcaagcaccgcccgctgctggacgtgtga

DBGET integrated database retrieval system