KEGG   Cupriavidus metallidurans: Rmet_1349Help
Entry
Rmet_1349         CDS       T00351                                 

Gene name
trbG
Definition
(GenBank) Conjugal transfer protein TrbG/VirB9/CagX precursor putative exported protein(protein belongs to CMGI-2)
  KO
K20532  type IV secretion system protein TrbG
Organism
rme  Cupriavidus metallidurans
Pathway
rme02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:rme00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Rmet_1349 (trbG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rme02044]
    Rmet_1349 (trbG)
Secretion system [BR:rme02044]
 Type IV secretion system
  Trb secretion system protein
   Rmet_1349 (trbG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CagX
Motif
Other DBs
NCBI-ProteinID: ABF08232
UniProt: Q1LNP4
Position
1458098..1459090
Genome map
AA seq 330 aa AA seqDB search
MNDLFRKSALPVILLALVGCASQGKPPPTISLDEPVQAQPLPEPPAPVEVVAVPEVLPMP
AQLKPLPEAEDAKPAPEPADEKVRVSRANAEARVAPTREGYVNAIQVWPFTDGALYQVYA
AVGRVTVVSLQPGEELVTVAAGDTVRWIVGDTSSGSGADLRVNVLVKPIRSGLKTNLVIT
TSRRTYLLELASTEKTWMASVSWEYPRDRMLALQRQAQAANAAAPVDAGLALENLRFRYA
ISGSNPPWKPLRAFDDGQKVYIQFPAGIAQGELPPLFVIGPEGDGQLVNYRFRSPYYIVD
RLFGAAELRLGGDKGAMVRIERTDGVARRN
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatcttttccgtaaatccgctttgccggtgatcctgcttgccctcgtgggctgc
gcctcgcagggcaagccaccgccgaccatctcgctcgatgagccggtgcaggcccagccg
ctgccggagccgcccgcgccggtggaggtggtggccgtgcccgaggttctaccgatgccg
gcgcagttgaagccgttgcccgaagctgaggacgccaaacctgcgccggagccggctgac
gagaaggtgcgcgtctcgcgcgccaatgccgaggcccgcgtagcccccacgcgcgagggc
tacgtcaatgcgattcaggtttggcccttcacggacggggcgctctatcaggtctatgcg
gccgtgggccgcgtgaccgtggtttcgctccagccgggcgaggaactggtgacggtggcc
gctggcgataccgtgcgctggatcgtgggcgacacgtccagcggcagcggtgccgatctg
cgcgtgaacgtgctggtcaagccgattcgctcaggcctcaagaccaatctcgtcatcacc
accagccgcaggacgtacctgctggagctggcttcgacggaaaagacgtggatggcgtcg
gtgtcctgggagtacccgcgcgaccggatgctggcgctacagcgccaagcgcaggcggcc
aatgccgccgcgccggtcgatgccgggctggcgctagagaacctgcgcttccgctacgca
atcagcggcagcaatccgccgtggaagccgttgcgcgccttcgacgacgggcagaaggtc
tatatccagttccccgctggcatcgcgcaaggcgagctgccgccgctgttcgtgataggg
ccggaaggcgacgggcaactggtgaactaccgcttccgctcgccgtactacatcgtggat
cgcctctttggcgcggcagagctgcgcctgggcggcgacaagggcgccatggtgcggatc
gagcgcacggatggcgtggcacggaggaactga

DBGET integrated database retrieval system