KEGG   Cupriavidus metallidurans: Rmet_1441Help
Entry
Rmet_1441         CDS       T00351                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
rme  Cupriavidus metallidurans
Pathway
rme00900  Terpenoid backbone biosynthesis
rme01100  Metabolic pathways
rme01110  Biosynthesis of secondary metabolites
rme01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rme00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Rmet_1441 (dxr)
Enzymes [BR:rme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Rmet_1441 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C FAD_binding_2 Semialdhyde_dh Sacchrp_dh_NADP NmrA
Motif
Other DBs
NCBI-ProteinID: ABF08324
UniProt: Q1LNF2
Position
1561512..1562690
Genome map
AA seq 392 aa AA seqDB search
MQRITILGATGSIGESTLDVVRRHPDRYSVHALSAHRQVDKLAAACVEFRPARAVVGSAE
AARELEAKLRAAGVPTEVSYGETALESIAEDAGTDAVMAAIVGAAGLRSSLAAARAGKRV
LLANKESLVMSGGIFMDAVREHGATLLPIDSEHNAIFQCLPTSDPRYGAGVSKVLLTASG
GPFRTRDPSTLHDITPDQACAHPKWVMGRKISVDSATMMNKGLEVIEAHWLFGAPAEKIE
VLIHPQSIVHSMVAYADGSVLAQLGNPDMRTPIAYGMAYPERIDSGVTPLDLTVAGGLHF
ETPDLERFPCLGLAFDALRAGGVAPAVLNAANEVAVEAFLNGKIRFTDIARVVATVLEQP
ADGSADTLEGVLAADSAARRGAQAQLGSLAGR
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgcatcaccatcctcggcgctacgggttccatcggcgagagcacgcttgacgtg
gttcggcgccatccggatcgctactctgtccacgcactcagcgcgcatcggcaagtcgac
aagctggcggccgcctgcgtggagtttcgtcccgcgcgggccgtggtagggtcggccgag
gcggcgcgtgaactcgaagccaagctgcgtgccgccggtgttcccaccgaggtgagctat
ggcgagaccgcgcttgaatccatcgccgaggacgctggcacggatgcagtgatggccgcc
atcgtcggtgcggcaggcttgcgatcctcgctggcggctgctcgggccggcaaacgtgtg
ctgctggccaacaaggaatcgctcgtgatgtccggcggcatcttcatggatgccgtgcgt
gagcatggcgccacgctgctgcccatcgacagcgaacacaacgccatcttccagtgcctg
ccgaccagtgatccgcgctatggcgccggggtatcgaaggtgctgcttaccgcctcgggt
ggcccgttccgcacgcgtgatccgtccacgctgcacgacatcacgcccgaccaggcctgc
gcgcatccgaagtgggtgatggggcggaagatatcggtcgattccgcgacgatgatgaac
aagggtctcgaggtcatcgaggcgcactggctgtttggcgcgccggccgagaaaatcgag
gtgctgatccatccgcaaagcattgtccactcgatggtggcctacgcggacggctccgtg
ctggcgcaactgggcaaccccgacatgcggacacccatcgcctacggtatggcctatccg
gagcggatcgactccggtgtaacgccgctcgatctgacggttgccggtggcctgcatttt
gagactccagaccttgagcgcttcccatgccttgggctagcctttgatgcattgcgtgcc
ggcggcgtggcgcccgcagtgctaaatgcagccaacgaggtggccgtggaagcgttcctg
aacggcaagatccgcttcaccgatatcgctcgcgtggtggcaaccgtgctggagcagccg
gcggacggatcggctgatacgctcgagggcgtgctggctgccgattcagcagcgcgtcgc
ggcgcgcaggcgcagttgggaagcctggctggccgttga

DBGET integrated database retrieval system