KEGG   Cupriavidus metallidurans: Rmet_1481Help
Entry
Rmet_1481         CDS       T00351                                 

Gene name
ydcN
Definition
(GenBank) putative DNA-binding transcriptional regulator
Organism
rme  Cupriavidus metallidurans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_3 HTH_31 HTH_19 HTH_26 HTH_25
Motif
Other DBs
NCBI-ProteinID: ABF08364
UniProt: Q1LNB2
Position
complement(1602448..1602741)
Genome map
AA seq 97 aa AA seqDB search
MQKRTVQRGRPAGSTTHDAELAHAFGAAVRALRMERGIAQESLAHQAGIERSHMGKIERG
EHMPTLAIIFKIAGALECSTAVLMSEAESQLAAAAQP
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
atgcagaagcgaaccgtccagcgcggccgaccggccggctccaccacccacgacgccgag
ttggctcacgccttcggcgcggcggtgcgtgcgctgcggatggaacgcggaatcgcgcag
gaatcgctggcacaccaggccggcatcgagcgttcccacatgggcaagatcgaacgcggc
gagcacatgcccacgctggcgatcatcttcaagatagctggcgcgctcgaatgcagcacg
gccgtgctgatgagcgaggctgaaagccagctcgcagcagcggcccagccgtag

DBGET integrated database retrieval system