KEGG   Cupriavidus metallidurans: Rmet_1487Help
Entry
Rmet_1487         CDS       T00351                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rme  Cupriavidus metallidurans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2840 Rubella_E2
Motif
Other DBs
NCBI-ProteinID: ABF08370
UniProt: Q1LNA6
Position
1606858..1607400
Genome map
AA seq 180 aa AA seqDB search
MIASALPAADAATAATSPSPARAARPISTLLTRVSLAFLEHRFKLYLRFGEPARTQRLDR
WRSLAVFMPNAVFCRIRWQANDYGTVRWQLMVMQACTPLDAAQRIPGVQPGARLLLHVEG
ENQVRAVLERIDAIEALGIAPSAASPAYWRTLANRLAARLPLPEYTAERHAAWLIGKELP
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcatccgctttgcctgccgctgacgcggccacggctgcaacgtcgccgtcacca
gcacgcgcggcgcggcctatctcaacgctgctgacgcgcgtttcgctagccttcctagag
caccgtttcaagctctatctgcgctttggcgaaccggcgcgcacgcagcggctcgaccgc
tggcgcagtctcgccgtgttcatgcccaatgccgtgttctgccgcattcgctggcaggcc
aacgactacggcaccgtgcgctggcaactcatggtgatgcaggcttgcacgccgctcgat
gcggcgcagcgcatccccggcgtgcagcccggcgcacgcctgttgctgcacgtcgagggg
gagaaccaggtgcgcgccgtgctggaacgcattgacgccatcgaggcgctgggtatcgcg
ccgtccgccgcttcgcccgcgtactggcgcacgcttgccaaccggctcgctgcgcgcctg
ccgctgcccgaatacaccgccgagcggcacgccgcatggctgatcgggaaggaactgcca
tga

DBGET integrated database retrieval system