KEGG   Cupriavidus metallidurans: Rmet_1489Help
Entry
Rmet_1489         CDS       T00351                                 

Gene name
virD2
Definition
(GenBank) Relaxase type IV secretory pathway VirD2
Organism
rme  Cupriavidus metallidurans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3363
Motif
Other DBs
NCBI-ProteinID: ABF08372
UniProt: Q1LNA4
Position
1608307..1610409
Genome map
AA seq 700 aa AA seqDB search
MGVARHAAASPPCRLGREARADAGMSACFARPDTPELAGSTAMTDRRDDDFRIRPGAPKN
RGQGFVSKVLKQASKASGGKSSVRRPGGSGKGAGTGQRPGSRLGRGHTAARFAGAKLTPM
SRRVTIKTLLVNQQRASPQSLAKHLRYIERDGVGRDGEPGQAYGPQTDAADLDAFKERCA
DDRHHFRFILSPEDGAELEDLRTYTRHLMGRMEADLGTRLDWVAVDHWNTDNPHTHLIVR
GRDDTCKDLIIAGDYIADGFRHRAAELATEWLGPRTELEIQQTLQREVEQERWTSLDRTL
KRELGDDGLVHVERLNEPRLQRQRLLLVGRLQRLQRLGLADEMQPGTWAVHSNAEKTLRA
LGERGDIIRTMQRAMRGEPRELAVFEPGDDGRSIVGRVAAKGLTDELRDRGYLVIDGVDG
KAHYAALNARDELANYPTGAVVEVKGSADVRAADRNIAALASDGLYRTDHHLAIAQGQAV
PGRDPQEVVAAHVRRLEALRRAGIVERVAEGLWKVPDDLPEHGRRYDAQRLGGVAVELKS
HLPIERQARVIGATWLDQQLIGGGSGLGDLGFGGEVKQAMQQRADFLAEQGLAERRGQRL
ILARNLLSTLRNRELAQAAKDIAADTGLEHRPVSDGQRVAGIYRRSVMLASGRYAMLDDG
MGFSLVPWKPIIEQRLGQQLTATVRNGGVSWGFGRERGLA
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgggggtggcgcggcacgcagcggcttcgccaccgtgccgcttgggacgcgaggcccgc
gccgatgcgggcatgtccgcgtgctttgcacgaccagacacgccggagcttgcagggagc
acagccatgaccgaccgccgcgacgacgatttccgcatccgccccggcgccccgaagaac
cggggccagggcttcgtctccaaggtgctcaagcaggcgagcaaggccagcggcggcaag
tcctcggtgcgccgtccaggcggcagtggcaagggcgctggcactggccagcggcccggc
tcacgcctggggcgcggccacacggcggcgcgcttcgcgggagcgaagctgacgcccatg
tcgcggcgcgtgaccatcaagacgctgctggtcaaccagcagcgggccagcccgcagtcg
ctcgccaagcacctgcgctacatcgagcgcgatggcgtgggccgcgatggcgagccgggc
caagcctacgggccgcagactgatgccgccgacctcgatgccttcaaggaacgctgcgcc
gacgaccggcaccatttccgcttcatcctctcgcccgaggatggcgcggagctggaagac
ctgcgcacctacacgcgccacctgatgggccgcatggaggccgacctggggacgcggctg
gattgggtggcagtcgatcactggaacaccgacaacccgcacacacacctgatcgtgcgc
gggcgcgacgacacctgcaaggacctcatcatcgcgggggactacatcgccgatggcttc
cgtcatcgcgccgccgaactggcgaccgaatggctggggccacgcaccgagctggagatc
cagcagaccttgcagcgcgaggtggagcaggagcgatggacgagcctggatcgcacgctc
aagcgcgaactgggcgacgatggcctggtgcatgtcgaacggctcaacgagccgaggttg
caacgccagcgcctgctgctggtcggccgcctgcaacgcttgcagcgcctgggcctggcc
gacgagatgcagccgggcacctgggccgtccattccaatgcggagaaaaccctgcgcgcc
ctgggcgagcgtggcgacatcatccgcaccatgcagcgggccatgcgcggcgagccgcgc
gagctggcggtgttcgagccgggcgacgacggccgcagcatcgtcggccgcgtggccgcg
aaggggctgaccgacgagctgcgcgaccgcggctatctggtcatcgacggtgtggacggc
aaggcccactacgctgcgctcaacgcccgcgacgaactggcgaactatcccaccggcgcc
gtggtggaggtgaagggatcggccgacgtgcgcgcggccgaccggaacattgccgcactg
gcgagcgatggcctgtaccgcaccgatcatcaccttgccatcgcgcagggtcaggctgtg
cccggccgcgatccgcaggaagtcgtcgcggcccatgtccgccggctggaagccctgcgc
cgcgcaggcatcgtggagcgcgtggccgaagggctatggaaggtgccggacgacctgccc
gaacacggccgccgctacgacgcgcagcgcctgggcggcgtggcggtggaactgaaatcg
cacctgcccatcgagcggcaggcccgcgtgatcggggccacctggctcgaccagcaactg
atcggcggcggctcgggcctgggcgacctcggctttggcggtgaggtcaaacaggcgatg
cagcagcgcgcagatttcctggcggaacaggggctagccgagcggcgcgggcagcgcctg
atcctcgctcggaacctgctgagcaccttgcgcaatcgggaactggcgcaggccgcgaag
gacattgccgccgacaccggcctggagcatcggcccgtgtccgacggccagcgcgtggct
ggcatctaccggcgctccgtcatgctcgccagcggacgctacgccatgctcgatgacggc
atggggttcagcctggtgccgtggaaaccaataatcgaacaaaggctgggacagcaactc
accgccaccgtgcgcaacggtggagtgtcttggggatttggccgggagcgtggtttagcg
tga

DBGET integrated database retrieval system