KEGG   Cupriavidus metallidurans: Rmet_1947Help
Entry
Rmet_1947         CDS       T00351                                 

Gene name
ompR
Definition
(GenBank) two-component transcriptional regulator, winged helix family
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
rme  Cupriavidus metallidurans
Pathway
rme02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Rmet_1947 (ompR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:rme02022]
    Rmet_1947 (ompR)
Two-component system [BR:rme02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   Rmet_1947 (ompR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: ABF08826
UniProt: Q1LM00
Position
2117483..2118205
Genome map
AA seq 240 aa AA seqDB search
MENTSHKILVVDDDPRLRDLLRRYLGEQGFTVLVAENATAMNKLWLRERFDLLVLDLMMP
GEDGLSICRRLRGANDQTPIIMLTAKGEDVDRIVGLEMGADDYLPKPFNPRELIARIHAV
LRRKGPAEVPGAPSETPETFAFGDFVLNLATRTLTKNDEEITLTTGEFSVLKVFARHPRQ
PLSREKLMEMARGREYEVFDRSLDVQISRLRKLIEPDPGNPRFIQTVWGLGYVFIPDGVK
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggaaaataccagccacaagattctcgtcgtggacgacgacccgcgcctgcgcgatctt
ctacgccgctatctcggcgagcagggcttcacggtcctcgtggcggaaaacgccacggcc
atgaataagctctggctgcgcgagcgtttcgacctgctggtgctggacctgatgatgccg
ggcgaggacggcctttccatctgccgccgcctgcgaggcgccaacgaccagaccccgatc
atcatgctcaccgccaagggtgaggacgtggaccgtatcgtcggcctggaaatgggcgcg
gacgactatctgcccaagcccttcaacccgcgtgaactgatcgcgcggattcacgccgtg
ctgcgccgcaagggtcccgccgaagtgcctggcgccccgtcggaaaccccggaaacgttc
gccttcggcgatttcgtactcaacctggccacgcgtacgctgaccaagaacgacgaggaa
atcacgctcaccacgggcgagttctcggtgctcaaggttttcgcgcgccacccacgccag
ccgctctcgcgcgaaaagctcatggaaatggcacgcggccgcgagtacgaagtcttcgac
cgcagcctggacgtgcagatttctcgcctgcgcaagctgatcgagccggatccgggtaac
ccgcgcttcatccagacggtctggggcctgggttatgtctttatccccgatggcgtgaag
taa

DBGET integrated database retrieval system