KEGG   Cupriavidus metallidurans: Rmet_2049Help
Entry
Rmet_2049         CDS       T00351                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoamide succinyltransferase (E2 component)
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rme  Cupriavidus metallidurans
Pathway
rme00020  Citrate cycle (TCA cycle)
rme00310  Lysine degradation
rme01100  Metabolic pathways
rme01110  Biosynthesis of secondary metabolites
rme01120  Microbial metabolism in diverse environments
rme01130  Biosynthesis of antibiotics
rme01200  Carbon metabolism
Module
rme_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rme_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rme00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rmet_2049 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    Rmet_2049 (sucB)
Enzymes [BR:rme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Rmet_2049 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ABF08928
UniProt: Q1LLP8
Position
complement(2218115..2219374)
Genome map
AA seq 419 aa AA seqDB search
MAIVDVKVPQLSESVAEATMLNWKKKPGEAVAQDEILIEIETDKVVLEVPAPSAGVLSQI
IKNDGDTVVADEVIAKIDTAATAGAVAPAAAAPAPAAAAPAPAAAAPAAAASAGAIAMPS
AAKLMAEGGLSASQVAGTGKDGRITKGDVLAAGSAPAPAAKAAPAPAAAKPALPQVSAQV
DFAALGDRPEERVPMSRLRARIAERLIQSQSTNAILTTFNEVNMKPVMDLRAKYKDRFEK
EHGVKLGFMSFFVKAAVHALKKYPVINASVDGNDIVYHGYFDIGIAVGSPRGLVVPILRN
ADQMSLADIEKKIAEFGTKARDGKLSLEELTGGTFSISNGGTFGSMLSTPIINPPQSAIL
GVHATKDRAVVEDGQIVIRPMNYLAMSYDHRIIDGREAVLGLVAMKEALEDPARLLLDL
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggctattgttgacgtcaaggttccccaattgtcggaatcggtcgccgaagcgaccatg
ctgaactggaagaagaagccgggcgaagctgttgctcaggacgagatcctgatcgaaatc
gaaaccgacaaggttgtgctggaagtgccggcaccgtcggctggcgttctgtcgcagatc
atcaagaacgacggcgataccgtcgtggccgatgaagtgatcgccaagattgacacggca
gccaccgcaggcgctgtggcaccggccgccgccgctccggctcccgccgcagcagcaccg
gccccggcagctgctgcccccgcagccgctgccagcgctggcgccatcgccatgccgtcg
gctgccaagctgatggccgaaggtggcctgtcggcttcgcaagtggctggcaccggcaag
gacggccgcatcaccaagggtgacgtgctggccgccggctcggctcccgctccggccgcc
aaggctgctccggctccggccgccgccaagccggccctgccgcaagtgtcggcccaggtt
gacttcgccgcgctgggcgatcgcccggaagagcgcgtgccgatgagccgcctgcgcgcg
cgtatcgccgagcgtctgatccagtcgcaatcgaccaacgccattctcaccaccttcaac
gaagtgaacatgaagccggtgatggatctgcgcgccaagtacaaggatcgcttcgagaag
gaacatggtgtgaagctgggcttcatgtcgttcttcgtgaaggccgccgtgcacgcgctg
aagaagtacccggtcatcaacgcctcggtggacggcaacgacatcgtctaccacggctac
ttcgacatcggtatcgccgtgggctcgccgcgtggtctggtggtgccgatcctgcgcaac
gccgaccagatgagcctggccgacatcgagaagaagatcgccgagttcggcaccaaggcg
cgtgacggcaagctgtcgctggaagaactgaccggcggtacgttctcgatctcgaacggc
ggtacgttcggctcgatgctgtcgaccccgatcatcaacccgccgcagtcggccatcctg
ggcgtgcacgccaccaaggaccgtgccgtggtggaagacggccagatcgtgatccgtccg
atgaactacctggcgatgtcctacgaccaccgtatcatcgacggccgcgaagccgttctg
ggtctggtggccatgaaggaagcgctggaagatccggctcgtctgctgctggacctgtaa

DBGET integrated database retrieval system