KEGG   Cupriavidus metallidurans: Rmet_2270Help
Entry
Rmet_2270         CDS       T00351                                 

Gene name
acs
Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rme  Cupriavidus metallidurans
Pathway
rme00010  Glycolysis / Gluconeogenesis
rme00620  Pyruvate metabolism
rme00640  Propanoate metabolism
rme00680  Methane metabolism
rme01100  Metabolic pathways
rme01110  Biosynthesis of secondary metabolites
rme01120  Microbial metabolism in diverse environments
rme01130  Biosynthesis of antibiotics
rme01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rme00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rmet_2270 (acs)
   00620 Pyruvate metabolism
    Rmet_2270 (acs)
   00640 Propanoate metabolism
    Rmet_2270 (acs)
  Energy metabolism
   00680 Methane metabolism
    Rmet_2270 (acs)
Enzymes [BR:rme01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Rmet_2270 (acs)
Lipid biosynthesis proteins [BR:rme01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Rmet_2270 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABF09149
UniProt: Q1LL27
Position
complement(2491533..2493515)
Genome map
AA seq 660 aa AA seqDB search
MSAIESVMQEHRVFNPPASFAKTAAIPSMEAYQALCDEAAKDYEGFWARHARELLHWHKP
FTKVLDESNAPFYKWFEDGEINASYNCLDRNVEKGLGDKTAIVFEADDGTVTRVSYQELL
AKVSRFANGMKALGIKKGDRVVIYMPMSVEGVVAMQACARIGATHSVVFGGFSAKSLQER
LVDVGAVALITADEQMRGGKALPLKAIADEALTLGGCEAVKNVIVYRRTGGNVAWTEGRD
RSMEDVAAGQSDNCPAEPVGAEHPLFVLYTSGSTGKPKGVQHSTGGYLLWALMTMRWTFD
IKPDDMFWCTADIGWVTGHTYITYGPLAAGATQIVFEGVPTFPNAGRFWDMIQRHKVSIF
YTAPTAIRSLIKAAEADEKIHPKQYDLSSLRLLGTVGEPINPEAWMWYYKNIGRERCPIV
DTFWQTETGGHMITPLPGATPLVPGSCTLPLPGIMAAIVDETGQDVPNGNGGILVVKRPW
PSMIRTIWGDPERFKKSYYPEELGGKLYLAGDGSIRDKETGYFTIMGRIDDVLNVSGHRM
GTMEIESALVSNPIVAEAAVVGRPDDTTGEAICAFVVLKRSRPTAEEAVKIAAELRNWVG
KEIGPIAKPKDIRFGDNLPKTRSGKIMRRLLRSLAKGEDITQDTSTLENPAILDQLKQAQ
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccatcgagtcggtgatgcaggagcatcgcgttttcaatccccctgcgtcgttc
gccaagaccgccgcgatccccagcatggaggcctaccaggccctgtgcgacgaggctgca
aaggattacgagggcttctgggcccgccacgcacgcgagctgctgcattggcacaagccg
ttcacgaaggtgctcgacgagagcaacgcgccgttctacaagtggttcgaggatggcgag
atcaatgcctcgtacaactgcctcgaccgcaatgtcgagaagggcctcggcgacaagacg
gccatcgtcttcgaggccgacgacggcacggtgacgcgcgtcagctaccaggaattgctg
gcgaaggtcagccgcttcgccaacggcatgaaggcccttggcatcaagaagggcgaccgc
gtcgtgatctacatgccaatgtctgtcgaaggcgtcgtggccatgcaggcctgcgcgcgc
atcggcgccacgcactcggtggtgttcggcggcttctcggcgaagtccctgcaggaacgt
ctggtggacgtgggcgccgtggcgctgatcacggccgatgagcagatgcgtggtggcaag
gcgctgccgctgaaggccatcgctgacgaggcgctgacgctgggcggctgcgaggccgtc
aagaacgtgatcgtctatcgccgcacgggcggcaacgttgcctggaccgaaggccgtgat
cgttcgatggaagacgtcgccgccggtcagtccgataactgccccgccgagcccgttggc
gccgagcacccgctgttcgtgctctacacgtcgggctccaccggcaagccgaagggcgtg
cagcacagcacgggcggttacctgctgtgggcgctgatgacgatgcgctggaccttcgat
atcaagcccgatgacatgttctggtgcacggccgatatcggctgggtcaccggccacacc
tatatcacctacggcccgctggccgcaggcgccacgcagatcgtgttcgaaggcgtgccg
acgttcccgaacgccggccggttctgggacatgatccagcgccacaaggtctcgatcttc
tacaccgcgccgacggcgatccgctcgctgatcaaggccgccgaggccgacgagaagatc
catccgaagcagtacgacctctcgagcctgcgcctgctgggcaccgtgggcgagccgatc
aatccagaggcatggatgtggtactacaagaatatcggccgcgagcgttgcccgatcgtc
gatacgttctggcagaccgaaactggcggccacatgatcacgccgctgccgggcgccacg
ccgctggtgccgggctcgtgcacgctgccgctgccgggcatcatggcggccatcgtcgac
gaaaccgggcaggacgtgccgaacggcaatggtggcatcctggtcgtcaagcgtccgtgg
ccgtcgatgatccgcacgatctggggcgacccggagcgcttcaagaagagctactacccc
gaggaactcggcggcaaactgtacctggctggcgacggttcgatccgtgacaaggaaacc
gggtacttcacgatcatgggccgtatcgatgacgtgctgaacgtgtcgggccatcgcatg
ggcacgatggaaatcgagtcagcgctggtctcgaacccgatcgtggccgaggccgccgtg
gtgggtcgtcccgatgacaccaccggcgaggcgatctgcgcgttcgtggtgctcaagcgt
tcgcggccgacggctgaagaagccgtgaagatcgcggccgagctgcgcaactgggtgggc
aaggaaatcggcccgatcgccaagccgaaggacatccgcttcggcgacaatctgcccaag
acgcgttcgggcaagatcatgcgccgcctgctgcgttcgctggccaagggcgaggacatc
acgcaggacacctcgacgctggagaacccggccattctcgatcagctcaagcaagcccag
taa

DBGET integrated database retrieval system