KEGG   Cupriavidus metallidurans: Rmet_2350Help
Entry
Rmet_2350         CDS       T00351                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rme  Cupriavidus metallidurans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3438
Motif
Other DBs
NCBI-ProteinID: ABF09227
UniProt: Q1LKU9
Position
2561490..2562401
Genome map
AA seq 303 aa AA seqDB search
MKHPVLALLGLLAVAAAPVAQAVEILRWERMPLAVPLKVGQERIVFIDRNVRVGVPAGVG
ERLRVQSAGGAVYLRASEPIEPTRLQLQDADTGALILLDIAAEPPKDGEAELEPVRIVEG
DSAPGRYGEQADSAEAPARAQGQAGARTARRETPVPVVLTRFAAQNLYAPLRTVEPLPGV
MRVNLPRDLDLDTLMPTLPVRAVALASWRLEDQWVTAVRLTNTGADWVALDPRVLQGDFL
TATFQHEALGPRGTPEDTTVLYLVTGGRGLAQSLLPAIHRFDPAVHLPQPDGDENAKEAR
HAQ
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaagcatcctgtactcgcgctgctggggctactggccgtggccgcggcacccgtcgcc
caggcggtggagatcctgcgttgggaacgcatgccactggcagtgccgctgaaggtcggt
caggaacgcatcgtgttcatcgaccggaacgtgcgcgtgggcgtgcccgcgggcgtgggc
gaacgcctgcgcgtgcagagtgcgggtggcgcggtgtacctgcgcgccagcgagccgatc
gagcccacgcggttgcaactgcaggacgccgacacgggcgcgctgatcctgctggacatc
gcagccgaaccgcccaaggacggggaagccgagctggagccggtgcgcatcgtcgagggt
gacagcgcaccgggacgctatggcgagcaggccgacagtgccgaggccccggcacgcgcc
cagggccaggcaggtgcgcggaccgcgcggcgcgaaactccggtccctgtcgtgctgacg
cgcttcgccgcgcagaacctctacgcaccgctgcgcaccgtcgagccgcttccgggcgtc
atgcgggtcaacctgccccgcgacctcgacctggacacactgatgccaacgctgccggtg
cgcgcggtcgcgctcgcgtcgtggcgcctggaagaccaatgggtgactgccgtgcgcctt
accaacaccggcgccgactgggtcgcgctcgacccgcgcgtgctgcaaggcgatttcctc
accgccaccttccagcacgaggcgctgggcccgcgcggcacgcccgaggacacgaccgtc
ctctacctggtcacgggcggccgcggcctcgcgcagtcgctgctgccggcgattcaccgc
ttcgaccctgccgtgcatctgccgcagccggacggcgacgagaacgccaaggaggcccgc
catgcgcagtaa

DBGET integrated database retrieval system