KEGG   Cupriavidus metallidurans: Rmet_2357Help
Entry
Rmet_2357         CDS       T00351                                 

Definition
(GenBank) putative exported protein
Organism
rme  Cupriavidus metallidurans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraU
Motif
Other DBs
NCBI-ProteinID: ABF09234
UniProt: Q1LKU2
Position
2569188..2570138
Genome map
AA seq 316 aa AA seqDB search
MTYRPFDLLRRLRVAVASLLLVSATGSYALNTVTIVSSVMSPDCLEYRVVGICYWLYCTY
GGCSVRTSTKVRHYVPDAVVSSYSNTGENPWVEVRAMSMPNASAQAGGDGTTNEDHENNL
AKFKNADVIGHPGGEVFNQFASSSGYFCQGAGTAFMPYLLSTLDTLAWRYNVPEMAYPEA
LIPGRREVGARTTMNLWGNVYPRGGFLHQTDDHKSGAVVAQRAGDVVTRRGQLHVYQPLL
ANARDGYWPAGALMEGDASTGKWQELTPRLSNTCVVFPHSGTLTQAQQGDYAWALWRPYA
CCERRGQVFLGSVDFL
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
gtgacctatcgcccattcgacctgctgcgccgcctgcgcgtcgccgtggcctcgctgctg
ctggtcagcgccacgggcagctacgccctgaacaccgtcaccatcgtgtcctccgtcatg
tcgccggactgcctggagtaccgggtggtgggcatctgctactggctgtattgcacctat
ggcggctgctcggtgcgcacgtccaccaaggtccggcactacgtccccgatgcggtcgtc
tccagctacagcaacaccggagagaacccctgggtcgaagtgcgagcgatgagcatgccg
aacgcctcggcccaggcaggcggcgacggcaccaccaacgaagaccacgaaaacaacctc
gccaaattcaagaacgccgatgtcatcggccatcccggcggcgaggtgttcaaccagttc
gcctcgtcctcgggctatttttgccaaggcgcgggaacggccttcatgccgtatctgctc
agcaccttggacacgctggcctggcgctacaacgtgcccgagatggcctacccggaggcg
ctgatcccgggccggcgcgaggtcggtgcgcgcaccacgatgaacctctggggcaatgtc
tatccgcgcggcggcttcctgcaccagaccgacgaccacaaatccggggcggtcgtggct
cagcgcgccggtgacgtcgtcacgcggcgcgggcagttgcacgtgtaccagccgctgctc
gccaacgcgcgtgatggctactggccggccggcgcgctgatggaaggtgatgcctcgacc
ggcaagtggcaggaactgacgccgcgcctgtcgaacacctgcgtggtgttcccccacagc
ggcacgctgacccaagcccagcaaggcgactacgcgtgggcgctgtggcgtccgtatgcg
tgctgcgaacgccggggccaggtgttcctcggcagcgtcgatttcctctga

DBGET integrated database retrieval system