KEGG   Cupriavidus metallidurans: Rmet_2672Help
Entry
Rmet_2672         CDS       T00351                                 

Gene name
queC
Definition
(GenBank) Queuosine biosynthesis protein queC
  KO
K06920  7-cyano-7-deazaguanine synthase [EC:6.3.4.20]
Organism
rme  Cupriavidus metallidurans
Pathway
rme00790  Folate biosynthesis
rme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rme00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Rmet_2672 (queC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rme03016]
    Rmet_2672 (queC)
Enzymes [BR:rme01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.20  7-cyano-7-deazaguanine synthase
     Rmet_2672 (queC)
Transfer RNA biogenesis [BR:rme03016]
 Prokaryotic type
  tRNA modification factors
   Other tRNA modification factors
    Rmet_2672 (queC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: QueC Asn_synthase NAD_synthase ThiI tRNA_Me_trans Arginosuc_synth PAPS_reduct ATP_bind_3
Motif
Other DBs
NCBI-ProteinID: ABF09545
UniProt: Q1LJY1
Position
complement(2906324..2907007)
Genome map
AA seq 227 aa AA seqDB search
MTKRAIVLLSGGLDSATVLAMANAAGFETYALSMRYGQRHSSELEAAKRVAAELGAKRHE
IIDLDLRRFGGSALTDDALDVPTDGAAGGIPITYVPARNTIMLSLALGWAEAIGGRDLFF
GANAVDYSGYPDCRPEYVAAYETLANLATKAGVEGDRFHVHAPIIDMTKAEIILAGVKLG
VDYGLTVSCYKADDDGRACGVCDSCRIRRAGFEAAGVPDPTRYQTPN
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaacgcgccatcgttctgctttccggcggccttgattccgccaccgtcctcgcc
atggccaacgcggccggcttcgaaacctatgcgctgtccatgcgctatggccagcgccat
tcgtccgagcttgaagctgccaaacgcgtggcggccgaacttggcgcgaagcgccacgaa
atcatcgacctcgacctgcgccgtttcggtggctcagccctgaccgatgacgcgctcgac
gtgcccaccgacggcgccgcaggcggaattccgatcacttacgtgccggcgcgcaatacg
atcatgctgtcgctggcgcttggctgggccgaggcaatcggcggacgcgacctgtttttc
ggcgcgaatgccgtcgactactccggctatccggactgccggcccgaatatgtcgctgcc
tatgagacgctggccaacctggccacgaaggctggcgtggaaggcgatcgctttcacgtg
catgctccgatcatcgacatgaccaaggccgagatcattctcgctggcgtgaagctcggc
gtcgactacggcctgaccgtctcgtgctacaaggccgatgacgatggccgcgcgtgcggc
gtgtgcgattcgtgccggattcgccgggccggcttcgaggccgccggcgtgcccgacccg
acccgttaccagacccccaactga

DBGET integrated database retrieval system