KEGG   Cupriavidus metallidurans: Rmet_3995Help
Entry
Rmet_3995         CDS       T00351                                 

Gene name
bglX
Definition
(GenBank) beta-D-glucoside glucohydrolase, periplasmic
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
rme  Cupriavidus metallidurans
Pathway
rme00460  Cyanoamino acid metabolism
rme00500  Starch and sucrose metabolism
rme01100  Metabolic pathways
rme01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Rmet_3995 (bglX)
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    Rmet_3995 (bglX)
Enzymes [BR:rme01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     Rmet_3995 (bglX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_3_C Fn3-like PHP
Motif
Other DBs
NCBI-ProteinID: ABF10863
UniProt: Q1LG63
Position
megaplasmid:complement(563922..566246)
Genome map
AA seq 774 aa AA seqDB search
MRMLSTLALAAGLACAPLIAPTSVSSAYAADIQATGKSDKQALIADLIGRMTLDEKIGQL
RLISIGPEMPQPQLIKEIAAGRVGGTFNSITQAENRPLQDAAVMQSRLKIPMFFAYDVVH
GHRTVFPISLGLASSWDMGLVEKTARISAVEAAADGIDATFAPMVDISRDPRWGRTSEGF
GEDPYLVSQCARASVKGFQGASPANADSLMAFVKHFALYGAVEGGRDYNTVDMSLQRMYQ
DYLPPYRAGLDAGAGGVMIALNSINGQPATSNRWLLHDLLRKEWGFKGVTVSDHGAIDEL
LRHGVASNGREAAKLAIEAGVDISMADTRYLEQLPTLVKSGAVPVALIDDAVREVLGAKY
DMGLFADPFRRIGVAAQDPADVDAESRLHRAEAREAARKSIVLLENRNQTLPLRKSGKVA
VIGPLTDAQIDILGSWSAAGKPRQSVSLLQGMRDALAGKGEVIYARGANVTDDARVVGYL
NFLNWDSPEVVQDKRSPGEMIDEAVRTARDADAIVVAVGESRGMSHEASSRTSLSLPGSQ
EALLKALKTTGKPLVVVLMNGRPLTVNWEKDNADAMLETWYAGTEGGHAIADVLFGDENP
SGKLPVSFPRSIGQIPTYYNHLRIGRPFTPGKPANYTSQYFEEESGPLYPFGYGLSYTTF
SVSEIRLSSPKLARNGTINASVTVKNTGKYAGETVVQFYVQDVTASVVRPVKELKGFRKV
LLAPGESRAIEFPVTEDTLKFYNARLEYVAEPGDFNLQIGLDSASVREARFTLE
NT seq 2325 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatgctttccacgctggccctcgcggctggccttgcctgcgcgcccttgattgcg
ccaacttccgtatcgtcagcctacgcggcggacatccaagccaccggcaagtccgacaag
caggcgctcatcgccgatctgatcggccggatgacgctcgacgagaagatcggccagctc
cgcctgatcagcatcgggcccgagatgccgcagccgcagctcatcaaagagattgcggca
ggccgcgtgggcggcacgttcaactccatcacgcaagcggaaaaccgtccgctgcaggat
gcggcagtcatgcagagccggctgaagattccgatgttcttcgcctacgacgtggtccac
ggccatcgcaccgtgttcccgatcagccttggcctggcgtcgagctgggacatgggtctg
gtggaaaagaccgcgcggatttcagccgtggaagccgcagcagatggcatcgacgccacg
ttcgcgccgatggtcgacatctcgcgcgatccgcgctggggccgcacctcggaaggattc
ggcgaggacccgtatctggtatcgcaatgcgcgcgcgcaagcgtcaagggcttccagggc
gcgtccccggccaatgccgacagcctgatggccttcgtcaagcatttcgcgctgtacggc
gcggtagagggtgggcgtgactacaacaccgtggacatgagcctgcagcgcatgtaccag
gactacctgccgccctaccgcgccggtctggacgcgggtgccggcggcgtgatgatcgcg
ctgaattcgatcaacggccaacccgccacgtccaacagatggctgctgcatgacctgctg
cgcaaggaatggggcttcaagggcgtcaccgtcagcgaccacggcgcgatcgacgaactg
ctgcgccacggcgtggccagcaacggccgcgaggcggctaagctggccatcgaagctggc
gtggacatcagcatggcggacacgcgctatctggaacaactgccgaccctcgtgaaatcg
ggtgccgtgccggtagcgctgatcgacgatgccgtgcgtgaggtgcttggcgcgaagtac
gacatgggcctgttcgccgacccgttccgccgtatcggcgtcgcggcgcaggacccggcc
gatgtcgacgcggagagccgcctgcaccgcgccgaagcacgcgaggctgcccgcaagtcc
atcgtgctgctggaaaaccgcaaccagacgctgccgctgcgcaagtcaggcaaggtagcc
gtgatcggcccgctgaccgacgcgcagatcgacatcctgggtagttggtccgctgcgggc
aagcctcgtcaatcggtctcgctgctgcagggtatgcgcgacgcgctggccggcaagggc
gaggtgatttacgcgcgcggcgccaacgtgaccgacgacgcccgcgtggtcggctatctg
aacttcctgaactgggacagccccgaggtggtgcaggacaagcgctcgccgggagagatg
atcgacgaggcggtacgcacggcacgcgatgccgacgcgatcgtcgtggccgtgggcgag
tcgcgcggcatgtcccatgaggcctcgagccgcacgagcctgtcactgccgggcagccag
gaggcactgctcaaggcactgaagaccaccggcaagccgctggtggtggtactgatgaac
ggccgccccctgacagtcaattgggagaaggacaacgctgacgcgatgctcgagacctgg
tacgccggtaccgaaggcggtcacgcgatcgcggacgtgctattcggagacgagaatccg
tcgggcaagctgccggtctcgttcccgcgctcgatcggccagattccgacctattacaac
cacctgcgcattggccggccgttcacgccaggcaagccagccaactacacatcgcagtac
ttcgaggaagaatccggcccgctctacccgttcggctacggcctgagctacaccacgttc
agcgtgtccgaaatccggctgtcgagcccgaaactggcccgcaacgggacgatcaacgcc
agcgtgaccgtgaagaacaccggcaagtacgcaggggaaacggtagtgcagttctacgtg
caggacgtgaccgcatcggtcgtgcgccccgtcaaggaactcaagggattccgcaaggtg
ttgctcgcgcccggcgaatcgcgcgcgatcgaattccccgtcaccgaggacacgctcaag
ttctataacgcgcgccttgagtacgtggccgaaccgggcgatttcaatcttcagatcggc
ctggattcggcttcggtgcgcgaggcgcgattcacgctggaatga

DBGET integrated database retrieval system