KEGG   Cupriavidus metallidurans: Rmet_4943Help
Entry
Rmet_4943         CDS       T00351                                 

Definition
(GenBank) putative iron-containing alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
rme  Cupriavidus metallidurans
Pathway
rme00010  Glycolysis / Gluconeogenesis
rme00071  Fatty acid degradation
rme00350  Tyrosine metabolism
rme00625  Chloroalkane and chloroalkene degradation
rme00626  Naphthalene degradation
rme01100  Metabolic pathways
rme01110  Biosynthesis of secondary metabolites
rme01120  Microbial metabolism in diverse environments
rme01130  Biosynthesis of antibiotics
rme01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rme00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rmet_4943
  Lipid metabolism
   00071 Fatty acid degradation
    Rmet_4943
  Amino acid metabolism
   00350 Tyrosine metabolism
    Rmet_4943
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Rmet_4943
   00626 Naphthalene degradation
    Rmet_4943
Enzymes [BR:rme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Rmet_4943
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: ABF11805
UniProt: Q1LDH1
Position
megaplasmid:1608579..1609736
Genome map
AA seq 385 aa AA seqDB search
MNPFRFQTVPTVIVELGAARRLGALLREAFPQSQRLCVVTDGFLSKSGLLSPALDDLGKH
GWQVTLIDDVIADPPEHIVLEATERARQADAEVVLGLGGGSSMDVAKLIAVLLPAAQSLK
DMYGVKKVTGTRLPLVQMPTTAGTGSEVTAVSIVTTGETTKMGVVAPQLLADLAILDAEL
TLGLPRAATAATGIDAMVHAIEAYTSAHLKNPISDMLAVRALELLSQNLMLACDNGHDHG
AREAMLLGAMFAGQAFANSPVAAVHALAYPIGGIFHVAHGLSNALVLPHVMKFNAPAASK
LYAELADVILPGTTGSCETKTAALIAHIEGLVLATGIPRTLREVGVKENDLGRLARDAML
QTRLLVNNPREVTEADAFAIYSAAF
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgttccgtttccagaccgtgccgacggtcatcgtcgagcttggcgccgcgcgc
cggctgggagcgttgctgcgcgaggcctttccgcaatcgcaacgcctctgcgtggtaacc
gacggcttcctctcgaagagcggcctgctctcgccggcgctcgatgacctgggcaagcac
ggctggcaggtgaccctgatcgacgacgtgatcgccgacccgcccgagcacatcgtgctc
gaggccaccgagcgcgcgcggcaggccgatgcggaagtcgtactcgggctcggcggcgga
tcgtcgatggacgtcgccaagctgattgccgtgctgcttcctgccgcgcagtcgctcaag
gacatgtacggcgtgaagaaggtcacgggcacgcggctgccgctcgtgcagatgccgacc
accgccggcaccggctcggaagtgactgcagtgtcgatcgtcaccacgggagagaccacc
aagatgggggtggtggcgccgcagcttctggccgacctcgccattctcgacgccgaactc
acgcttggcctgccacgtgcggcgaccgcggccaccggtatcgacgcgatggtgcacgcg
atcgaggcctatacgagcgcgcatctgaagaacccgatctcggacatgctggccgtgcgc
gcgctggaactgctgtcgcagaacctgatgctcgcctgcgacaacggccacgaccacggc
gcgcgcgaagccatgctgctcggcgcgatgttcgccggccaggccttcgccaattcgccg
gtggcggccgtgcacgcgctggcctatccgatcggcggcatcttccatgtcgcgcacggg
ctctccaacgcgctcgtgctgccgcacgtcatgaagttcaacgcgccggcagccagcaag
ctgtatgcggaactggccgacgtgatactgccgggcaccaccggtagctgcgaaaccaag
acggccgcgctgatcgcccatatcgagggactggtgctggccacgggcatcccgcgcaca
ttgcgcgaggttggcgtcaaggaaaatgatctgggccgtctggcccgcgatgcaatgctg
cagacacgcctgctggtcaacaatccgcgcgaggtcaccgaggccgacgcattcgcgatc
tacagcgcggcattctga

DBGET integrated database retrieval system