KEGG   Cupriavidus metallidurans: Rmet_5156Help
Entry
Rmet_5156         CDS       T00351                                 

Gene name
paaE
Definition
(GenBank) beta-ketoadipyl CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rme  Cupriavidus metallidurans
Pathway
rme00071  Fatty acid degradation
rme00072  Synthesis and degradation of ketone bodies
rme00280  Valine, leucine and isoleucine degradation
rme00310  Lysine degradation
rme00362  Benzoate degradation
rme00380  Tryptophan metabolism
rme00620  Pyruvate metabolism
rme00630  Glyoxylate and dicarboxylate metabolism
rme00640  Propanoate metabolism
rme00650  Butanoate metabolism
rme00900  Terpenoid backbone biosynthesis
rme01100  Metabolic pathways
rme01110  Biosynthesis of secondary metabolites
rme01120  Microbial metabolism in diverse environments
rme01130  Biosynthesis of antibiotics
rme01200  Carbon metabolism
rme01212  Fatty acid metabolism
rme02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rmet_5156 (paaE)
   00630 Glyoxylate and dicarboxylate metabolism
    Rmet_5156 (paaE)
   00640 Propanoate metabolism
    Rmet_5156 (paaE)
   00650 Butanoate metabolism
    Rmet_5156 (paaE)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Rmet_5156 (paaE)
   00072 Synthesis and degradation of ketone bodies
    Rmet_5156 (paaE)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rmet_5156 (paaE)
   00310 Lysine degradation
    Rmet_5156 (paaE)
   00380 Tryptophan metabolism
    Rmet_5156 (paaE)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Rmet_5156 (paaE)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Rmet_5156 (paaE)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Rmet_5156 (paaE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rme04147]
    Rmet_5156 (paaE)
Enzymes [BR:rme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Rmet_5156 (paaE)
Exosome [BR:rme04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rmet_5156 (paaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III DUF3367
Motif
Other DBs
NCBI-ProteinID: ABF12015
UniProt: Q1LCW1
Position
megaplasmid:complement(1854522..1855700)
Genome map
AA seq 392 aa AA seqDB search
MQQAFIIDAIRSPLGRSKPGSAFTELHATELLAQVLSQLVRRNDLDPGLVDDVITGCVTQ
AGEQSAGVGRVAWLAAGFPEHVPATTIDRKCGSSQQAVHFAAQGIMAGAYDIVIACGIES
MSRVPMGAARIGQNPYGPSFEERYAPGLVGQGVSAELVAAKWELSRHDMDSYSARSHQRA
AATQAAGGFKREIVGIQTVNGLVEQDETIRANTTVERLATLESPFRNDELSARFPQIGWN
VTAGNASQISDGAAAILIVSERMATKLGLKPRARFVGFDVIGANPLEMLTAPIPATQRVL
AKTGMTLEQIAHYEINEAFASVPMAWQKTMKADGARLNPRGGAIALGHPLGASGVRLMTT
MLHALEDSGERFGLQSMCEAGGMANATIIERV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaagctttcatcatcgacgcaatccgttcgccgctgggccgttccaagcccggc
tccgcctttaccgaactccatgccaccgaactgctggcccaggtgctgtcgcagctcgtg
cggcgcaatgaccttgacccgggtctggtcgatgacgtcatcaccggttgcgtgacgcag
gccggcgaacagtccgcaggggttgggcgcgtggcctggctggcggcgggctttccggag
cacgtgccggccaccaccatcgaccgcaagtgcggttcgagccagcaggccgttcacttt
gccgcgcagggcatcatggccggcgcgtacgacatcgtgattgcctgcggcatcgagtcc
atgagccgggtgccgatgggcgcggcgcgtattggccagaacccatatggtccgtcgttt
gaggaacgctacgcgccggggctggtcgggcagggcgtgtcggccgagctggttgccgcc
aagtgggagctttcgcgtcacgacatggacagctactcggcgcgctcgcaccagcgtgcc
gccgccacccaggcagccggcggattcaagcgcgagatcgtcggcatccagaccgtgaat
ggtctggtggagcaggacgagacgatccgcgccaacaccaccgtggagcgcctggcgacg
ctggagtcgccattccgcaacgacgaactgagtgcccgttttccgcagatcggctggaat
gttaccgccggcaacgcctcgcagatcagtgatggtgcggccgcaatcctgattgtcagc
gagcgcatggccacgaagctcggcctcaagccgcgcgcgcgttttgtcggtttcgacgtg
atcggcgccaatccgctggagatgctgaccgcgccgatccccgccacccagcgcgtgctg
gcaaagaccggcatgacgctcgagcagatcgcgcactacgaaatcaacgaggcattcgcc
agtgtgccgatggcctggcagaagacgatgaaggccgatggcgcgcgcctgaacccgcgc
ggtggcgcgatcgcgctaggtcacccgcttggcgcatcgggcgtgcggctgatgaccacc
atgctccatgcgctggaagacagcggcgagcgcttcggcctgcagtcgatgtgcgaagcg
ggcggcatggcgaacgccacgatcatcgagcgcgtctga

DBGET integrated database retrieval system