KEGG   Cupriavidus metallidurans: Rmet_5208Help
Entry
Rmet_5208         CDS       T00351                                 

Gene name
mhpF
Definition
(GenBank) acetaldehyde-CoA dehydrogenase II, NAD-binding
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
rme  Cupriavidus metallidurans
Pathway
rme00360  Phenylalanine metabolism
rme00362  Benzoate degradation
rme00620  Pyruvate metabolism
rme00621  Dioxin degradation
rme00622  Xylene degradation
rme00650  Butanoate metabolism
rme01100  Metabolic pathways
rme01120  Microbial metabolism in diverse environments
rme01220  Degradation of aromatic compounds
Module
rme_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:rme00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rmet_5208 (mhpF)
   00650 Butanoate metabolism
    Rmet_5208 (mhpF)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Rmet_5208 (mhpF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Rmet_5208 (mhpF)
   00622 Xylene degradation
    Rmet_5208 (mhpF)
   00621 Dioxin degradation
    Rmet_5208 (mhpF)
Enzymes [BR:rme01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Rmet_5208 (mhpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA F420_oxidored
Motif
Other DBs
NCBI-ProteinID: ABF12067
UniProt: Q1LCQ9
Position
megaplasmid:1902532..1903476
Genome map
AA seq 314 aa AA seqDB search
MKPCKVAIIGSGNIGTDLMIKILRHGKHVEMGAMVGIDPTSEGLARATRLGVPVTAAGID
GLLAMPEFGEIRIAFDATSAGAHARHNATLQAHNVRVIDLTPAAIGPYVVPSVNAGEHLD
APNLNMVTCGGQATIPIVAAVASVTPVHYAEIVASIASKSAGPGTRDNIDEFTETTSRAI
ESVGGARRGKAIIVLNPAEPPLIMRDTVCCLIDEADTAAIEAAVHAMVERMQGYVPGYRL
KQRVQFDRIDTPVNVPGLGPTTGLKVTVFLEVEGAAHYLPAYAGNLDIMTSAALACAERV
AQALGNHHALSAAS
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccctgcaaggtagccatcatcggttccggcaacatcggcaccgacctgatgatc
aagatcctgcgccacggcaagcatgtcgagatgggcgccatggtggggatcgatcccacc
tcggaaggcctggcgcgcgcgacacgcctcggcgtgccggtcaccgccgccggcatcgac
ggcctgctggccatgccggagttcggtgagatccgcatcgccttcgatgccaccagcgcc
ggcgcgcacgcccgccacaacgccacgctgcaggcgcacaacgtgcgcgtgatcgatctg
acaccagctgccatcggcccctacgtggtgcccagcgtcaatgccggcgaacatcttgat
gcgccgaacctcaacatggtcacctgcggcggccaggccaccattcccatcgtggcagcc
gtggccagcgtgacgccggtccactatgcggagatcgtggcctcgatcgcgagcaagtcc
gccggccccggcacgcgcgacaacatcgacgagttcacggaaacgacctcccgcgccatc
gaatcagtgggcggcgccaggcgcggcaaggccatcatcgttctcaacccggccgagccg
ccgctgatcatgcgcgacaccgtgtgctgcctgatcgacgaagccgacaccgcggcgatc
gaagccgcggtgcacgcgatggtggaacgcatgcagggctatgtgcccggataccggctc
aaacagcgtgtgcagttcgaccgcatcgacacaccggtgaatgtgcccggcctcggaccg
acgaccggcctgaaggtcacggtcttcctggaagtggaaggcgccgcgcactacctgccc
gcctatgcaggcaatctggacatcatgacgagcgccgcgctcgcatgcgccgaacgcgtc
gcacaggcattgggcaatcatcatgccctgtcggcagcaagctaa

DBGET integrated database retrieval system